Recombinant Human ADAMTS17 protein, GST-tagged

Cat.No. : ADAMTS17-16H
Product Overview : Recombinant Human ADAMTS17 protein(583-720 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 583-720 aa
Tag : N-GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : PGASVEHAVCENLPCPKGLPSFRDQQCQAHDRLSPKKKGLLTAVVVDDKPCELYCSPLGKESPLLVADRVLDGTPCGPYETDLCVHGKCQKIGCDGIIGSAAKEDRCGVCSGDGKTCHLVKGDFSHARGTALKDSGKG
Gene Name ADAMTS17 ADAM metallopeptidase with thrombospondin type 1 motif, 17 [ Homo sapiens ]
Official Symbol ADAMTS17
Synonyms ADAMTS17; ADAM metallopeptidase with thrombospondin type 1 motif, 17; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 17; A disintegrin and metalloproteinase with thrombospondin motifs 17; FLJ16363; FLJ32769; ADAM-TS17; ADAMTS-17; ADAM-TS 17; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 17;
Gene ID 170691
mRNA Refseq NM_139057
Protein Refseq NP_620688
MIM 607511
UniProt ID Q8TE56

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAMTS17 Products

Required fields are marked with *

My Review for All ADAMTS17 Products

Required fields are marked with *

0
cart-icon