Recombinant Human ADAMTS18 protein, His-tagged
Cat.No. : | ADAMTS18-2422H |
Product Overview : | Recombinant Human ADAMTS18 protein(892-1060 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 892-1060 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | GYINVKAICLRDQNTQVNSSFCSAKTKPVTEPKICNAFSCPAYWMPGEWSTCSKACAGGQQSRKIQCVQKKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKGSAAETLPESQCTSLPRPELQEGCVLGRCPKNSRLQWVASS |
Gene Name | ADAMTS18 ADAM metallopeptidase with thrombospondin type 1 motif, 18 [ Homo sapiens ] |
Official Symbol | ADAMTS18 |
Synonyms | ADAMTS18; ADAM metallopeptidase with thrombospondin type 1 motif, 18; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 18 , ADAMTS21; A disintegrin and metalloproteinase with thrombospondin motifs 18; disintegrin and metalloprotease-like protein; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 18; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 21; KNO2; ADAMTS21; |
Gene ID | 170692 |
mRNA Refseq | NM_199355 |
Protein Refseq | NP_955387 |
MIM | 607512 |
UniProt ID | Q8TE60 |
◆ Recombinant Proteins | ||
ADAMTS18-2422H | Recombinant Human ADAMTS18 protein, His-tagged | +Inquiry |
ADAMTS18-918HF | Recombinant Full Length Human ADAMTS18 Protein, GST-tagged | +Inquiry |
ADAMTS18-302H | Recombinant Human ADAMTS18 Protein, GST-tagged | +Inquiry |
ADAMTS18-326M | Recombinant Mouse ADAMTS18 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADAMTS18-4326H | Recombinant Human ADAMTS18 protein(913-1040aa), His-GST&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAMTS18-26HCL | Recombinant Human ADAMTS18 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMTS18 Products
Required fields are marked with *
My Review for All ADAMTS18 Products
Required fields are marked with *