Recombinant Human ADAMTS18 protein(913-1040aa), His-GST&Myc-tagged
Cat.No. : | ADAMTS18-4326H |
Product Overview : | Recombinant Human ADAMTS18 protein(Q8TE60)(913-1040aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 913-1040aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 49.1 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | CSAKTKPVTEPKICNAFSCPAYWMPGEWSTCSKACAGGQQSRKIQCVQKKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKGSAAETLPESQCTSLPRPELQ |
Gene Name | ADAMTS18 ADAM metallopeptidase with thrombospondin type 1 motif, 18 [ Homo sapiens ] |
Official Symbol | ADAMTS18 |
Synonyms | ADAMTS18; ADAM metallopeptidase with thrombospondin type 1 motif, 18; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 18 , ADAMTS21; A disintegrin and metalloproteinase with thrombospondin motifs 18; disintegrin and metalloprotease-like protein; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 18; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 21; KNO2; ADAMTS21; |
Gene ID | 170692 |
mRNA Refseq | NM_199355 |
Protein Refseq | NP_955387 |
MIM | 607512 |
UniProt ID | Q8TE60 |
◆ Recombinant Proteins | ||
ADAMTS18-302H | Recombinant Human ADAMTS18 Protein, GST-tagged | +Inquiry |
ADAMTS18-326M | Recombinant Mouse ADAMTS18 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADAMTS18-303H | Recombinant Human ADAMTS18 Protein, GST-tagged | +Inquiry |
ADAMTS18-26H | Recombinant Human ADAMTS18 protein, GST-tagged | +Inquiry |
ADAMTS18-918HF | Recombinant Full Length Human ADAMTS18 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAMTS18-26HCL | Recombinant Human ADAMTS18 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMTS18 Products
Required fields are marked with *
My Review for All ADAMTS18 Products
Required fields are marked with *
0
Inquiry Basket