Recombinant Human ADAMTS5 protein, GST-tagged
| Cat.No. : | ADAMTS5-3632H |
| Product Overview : | Recombinant Human ADAMTS5 protein(417-558 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 417-558 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | GLSHDDSKFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQILGPEELPGQTYDATQQCNLTFGPEYSVCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEGTPCGKGRICLQGKCVDKTK |
| Gene Name | ADAMTS5 ADAM metallopeptidase with thrombospondin type 1 motif, 5 [ Homo sapiens ] |
| Official Symbol | ADAMTS5 |
| Synonyms | ADAMTS5; ADAM metallopeptidase with thrombospondin type 1 motif, 5; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 5 (aggrecanase 2); A disintegrin and metalloproteinase with thrombospondin motifs 5; ADAMTS11; ADMP 2; aggrecanase 2; aggrecanase-2; a disintegrin and metalloproteinase with thrombospondin motifs 11; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 5 (aggrecanase-2); ADMP-2; ADAM-TS5; ADAMTS-5; ADAM-TS 5; ADAMTS-11; ADAM-TS 11; |
| Gene ID | 11096 |
| mRNA Refseq | NM_007038 |
| Protein Refseq | NP_008969 |
| MIM | 605007 |
| UniProt ID | Q9UNA0 |
| ◆ Recombinant Proteins | ||
| ADAMTS5-0159H | Recombinant Human ADAMTS5 Protein (Glu485-Pro622), N-His-tagged | +Inquiry |
| ADAMTS5-3632H | Recombinant Human ADAMTS5 protein, GST-tagged | +Inquiry |
| ADAMTS5-535H | Recombinant Human ADAMTS5 | +Inquiry |
| ADAMTS5-1755H | Recombinant Human ADAMTS5 protein, His & T7-tagged | +Inquiry |
| ADAMTS5-2037M | Recombinant Mouse ADAMTS5 Protein (262-930 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADAMTS5-9028HCL | Recombinant Human ADAMTS5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMTS5 Products
Required fields are marked with *
My Review for All ADAMTS5 Products
Required fields are marked with *
