Recombinant Human ADAMTS7 protein, GST-tagged

Cat.No. : ADAMTS7-17H
Product Overview : Recombinant Human ADAMTS7(1589 a.a. - 1686 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1589 a.a. - 1686 a.a.
Description : This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants encoding different isoforms have been identified.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.52 kDa
AA Sequence : VQRRLVKCVNTQTGLPEEDSDQCGHEAWPESSRPCGTEDCEPVEPPRCERDRLSFGFCETLRLLGRCQLPTIRTQCCRSCSPPSHGAPSRGHQRVARR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name ADAMTS7 ADAM metallopeptidase with thrombospondin type 1 motif, 7 [ Homo sapiens ]
Official Symbol ADAMTS7
Synonyms ADAMTS7; ADAM metallopeptidase with thrombospondin type 1 motif, 7; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7; A disintegrin and metalloproteinase with thrombospondin motifs 7; a disintegrin and metalloprotease with thrombospondin motifs 7 preproprotein; ADAM TS7; COMPase; DKFZp434H204; a disintegrin and metalloprotease with thrombospondin motifs-7 preproprotein; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7; ADAM-TS7; ADAMTS-7; ADAM-TS 7;
Gene ID 11173
mRNA Refseq NM_014272
Protein Refseq NP_055087
MIM 605009
UniProt ID Q9UKP4
Chromosome Location 15pter-qter
Function metal ion binding; metalloendopeptidase activity; metallopeptidase activity; peptidase activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAMTS7 Products

Required fields are marked with *

My Review for All ADAMTS7 Products

Required fields are marked with *

0
cart-icon