Recombinant Human ADAMTS7 protein, GST-tagged
Cat.No. : | ADAMTS7-17H |
Product Overview : | Recombinant Human ADAMTS7(1589 a.a. - 1686 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1589 a.a. - 1686 a.a. |
Description : | This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.52 kDa |
AA Sequence : | VQRRLVKCVNTQTGLPEEDSDQCGHEAWPESSRPCGTEDCEPVEPPRCERDRLSFGFCETLRLLGRCQLPTIRTQCCRSCSPPSHGAPSRGHQRVARR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | ADAMTS7 ADAM metallopeptidase with thrombospondin type 1 motif, 7 [ Homo sapiens ] |
Official Symbol | ADAMTS7 |
Synonyms | ADAMTS7; ADAM metallopeptidase with thrombospondin type 1 motif, 7; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7; A disintegrin and metalloproteinase with thrombospondin motifs 7; a disintegrin and metalloprotease with thrombospondin motifs 7 preproprotein; ADAM TS7; COMPase; DKFZp434H204; a disintegrin and metalloprotease with thrombospondin motifs-7 preproprotein; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7; ADAM-TS7; ADAMTS-7; ADAM-TS 7; |
Gene ID | 11173 |
mRNA Refseq | NM_014272 |
Protein Refseq | NP_055087 |
MIM | 605009 |
UniProt ID | Q9UKP4 |
Chromosome Location | 15pter-qter |
Function | metal ion binding; metalloendopeptidase activity; metallopeptidase activity; peptidase activity; zinc ion binding; |
◆ Recombinant Proteins | ||
Adamts7-509R | Recombinant Rat Adamts7 protein, His-tagged | +Inquiry |
ADAMTS7-1729H | Recombinant Human ADAMTS7 Protein (242-593 aa), His-tagged | +Inquiry |
ADAMTS7-18H | Recombinant Human ADAMTS7 protein, His-tagged | +Inquiry |
ADAMTS7-507R | Recombinant Rat ADAMTS7 Protein | +Inquiry |
ADAMTS7-1156H | Recombinant Human ADAMTS7 Protein (242-593 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMTS7 Products
Required fields are marked with *
My Review for All ADAMTS7 Products
Required fields are marked with *