Recombinant Human ADAMTS8 protein, His-SUMO-tagged
Cat.No. : | ADAMTS8-0161H |
Product Overview : | Recombinant Human ADAMTS8 protein(Q9UP79)(Gly441-Tyr600), fused with C-terminal His tag and N-terminal SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | Gly441-Tyr600 |
Tag : | N-SUMO & C-His |
Form : | Phosphate buffered saline |
Molecular Mass : | 31 kDa |
Storage : | Store at -20°C/-80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | GRMALYQLDQQCRQIFGPDFRHCPNTSAQDVCAQLWCHTDGAEPLCHTKNGSLPWADGTPCGPGHLCSEGSCLPEEEVERPKPVADGGWAPWGPWGECSRTCGGGVQFSHRECKDPEPQNGGRYCLGRRAKYQSCHTEECPPDGKSFREQQCEKYNAYNY |
Gene Name | ADAMTS8 ADAM metallopeptidase with thrombospondin type 1 motif, 8 [ Homo sapiens ] |
Official Symbol | ADAMTS8 |
Synonyms | ADAMTS8; ADAM metallopeptidase with thrombospondin type 1 motif, 8; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 8; A disintegrin and metalloproteinase with thrombospondin motifs 8; ADAM TS8; FLJ41712; METH2; METH-2; METH-8; ADAMTS-8; ADAM-TS 8; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 8; ADAM-TS8; |
Gene ID | 11095 |
mRNA Refseq | NM_007037 |
Protein Refseq | NP_008968 |
MIM | 605175 |
UniProt ID | Q9UP79 |
◆ Recombinant Proteins | ||
ADAMTS8-0161H | Recombinant Human ADAMTS8 protein, His-SUMO-tagged | +Inquiry |
Adamts8-3016M | Recombinant Mouse Adamts8, His-tagged | +Inquiry |
ADAMTS8-605HFL | Recombinant Full Length Human ADAMTS8 Protein, C-Flag-tagged | +Inquiry |
ADAMTS8-309H | Recombinant Human ADAMTS8 Protein, GST-tagged | +Inquiry |
ADAMTS8-29H | Recombinant Human ADAMTS8 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAMTS8-9027HCL | Recombinant Human ADAMTS8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMTS8 Products
Required fields are marked with *
My Review for All ADAMTS8 Products
Required fields are marked with *