Recombinant Human ADAMTS8 protein, His-SUMO-tagged

Cat.No. : ADAMTS8-0161H
Product Overview : Recombinant Human ADAMTS8 protein(Q9UP79)(Gly441-Tyr600), fused with C-terminal His tag and N-terminal SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : Gly441-Tyr600
Tag : N-SUMO & C-His
Form : Phosphate buffered saline
Molecular Mass : 31 kDa
Storage : Store at -20°C/-80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : GRMALYQLDQQCRQIFGPDFRHCPNTSAQDVCAQLWCHTDGAEPLCHTKNGSLPWADGTPCGPGHLCSEGSCLPEEEVERPKPVADGGWAPWGPWGECSRTCGGGVQFSHRECKDPEPQNGGRYCLGRRAKYQSCHTEECPPDGKSFREQQCEKYNAYNY
Gene Name ADAMTS8 ADAM metallopeptidase with thrombospondin type 1 motif, 8 [ Homo sapiens ]
Official Symbol ADAMTS8
Synonyms ADAMTS8; ADAM metallopeptidase with thrombospondin type 1 motif, 8; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 8; A disintegrin and metalloproteinase with thrombospondin motifs 8; ADAM TS8; FLJ41712; METH2; METH-2; METH-8; ADAMTS-8; ADAM-TS 8; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 8; ADAM-TS8;
Gene ID 11095
mRNA Refseq NM_007037
Protein Refseq NP_008968
MIM 605175
UniProt ID Q9UP79

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAMTS8 Products

Required fields are marked with *

My Review for All ADAMTS8 Products

Required fields are marked with *

0
cart-icon
0
compare icon