Recombinant Human ADAMTS8 protein, His-SUMO-tagged

• Cat.No.: ADAMTS8-0161H
• Product Overview: Recombinant Human ADAMTS8 protein(Q9UP79)(Gly441-Tyr600), fused with C-terminal His tag and N-terminal SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: Gly441-Tyr600
• Tag: N-SUMO & C-His
• Form: Phosphate buffered saline
• Molecular Mass: 31 kDa
• Storage: Store at -20°C/-80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: GRMALYQLDQQCRQIFGPDFRHCPNTSAQDVCAQLWCHTDGAEPLCHTKNGSLPWADGTPCGPGHLCSEGSCLPEEEVERPKPVADGGWAPWGPWGECSRTCGGGVQFSHRECKDPEPQNGGRYCLGRRAKYQSCHTEECPPDGKSFREQQCEKYNAYNY

Gene Information

• Gene Name: ADAMTS8 ADAM metallopeptidase with thrombospondin type 1 motif, 8 [ Homo sapiens ]
• Official Symbol: ADAMTS8
• Synonyms: ADAMTS8; ADAM metallopeptidase with thrombospondin type 1 motif, 8; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 8; A disintegrin and metalloproteinase with thrombospondin motifs 8; ADAM TS8; FLJ41712; METH2; METH-2; METH-8; ADAMTS-8; ADAM-TS 8; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 8; ADAM-TS8
• Gene ID: 11095
• mRNA Refseq: NM_007037
• Protein Refseq: NP_008968
• MIM: 605175
• UniProt ID: Q9UP79