Recombinant Human ADAMTS8 Protein, GST-tagged

Cat.No. : ADAMTS8-309H
Product Overview : Human ADAMTS8 partial ORF ( NP_008968, 781 a.a. - 890 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature enzyme. This enzyme contains two C-terminal TS motifs, and disrupts angiogenesis in vivo. A number of disorders have been mapped in the vicinity of this gene, most notably lung neoplasms. Reduced expression of this gene has been observed in multiple human cancers and this gene has been proposed as a potential tumor suppressor. [provided by RefSeq, Feb 2016]
Molecular Mass : 37.84 kDa
AA Sequence : RPLPEPLTVQLLTVPGEVFPPKVKYTFFVPNDVDFSMQSSKERATTNIIQPLLHAQWVLGDWSECSSTCGAGWQRRTVECRDPSGQASATCNKALKPEDAKPCESQLCPL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADAMTS8 ADAM metallopeptidase with thrombospondin type 1 motif, 8 [ Homo sapiens ]
Official Symbol ADAMTS8
Synonyms ADAMTS8; ADAM metallopeptidase with thrombospondin type 1 motif, 8; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 8; A disintegrin and metalloproteinase with thrombospondin motifs 8; ADAM TS8; FLJ41712; METH2; METH-2; METH-8; ADAMTS-8; ADAM-TS 8; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 8; ADAM-TS8;
Gene ID 11095
mRNA Refseq NM_007037
Protein Refseq NP_008968
MIM 605175
UniProt ID Q9UP79

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAMTS8 Products

Required fields are marked with *

My Review for All ADAMTS8 Products

Required fields are marked with *

0
cart-icon
0
compare icon