Recombinant Human ADAMTS8 Protein, GST-tagged
| Cat.No. : | ADAMTS8-309H |
| Product Overview : | Human ADAMTS8 partial ORF ( NP_008968, 781 a.a. - 890 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature enzyme. This enzyme contains two C-terminal TS motifs, and disrupts angiogenesis in vivo. A number of disorders have been mapped in the vicinity of this gene, most notably lung neoplasms. Reduced expression of this gene has been observed in multiple human cancers and this gene has been proposed as a potential tumor suppressor. [provided by RefSeq, Feb 2016] |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | RPLPEPLTVQLLTVPGEVFPPKVKYTFFVPNDVDFSMQSSKERATTNIIQPLLHAQWVLGDWSECSSTCGAGWQRRTVECRDPSGQASATCNKALKPEDAKPCESQLCPL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ADAMTS8 ADAM metallopeptidase with thrombospondin type 1 motif, 8 [ Homo sapiens ] |
| Official Symbol | ADAMTS8 |
| Synonyms | ADAMTS8; ADAM metallopeptidase with thrombospondin type 1 motif, 8; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 8; A disintegrin and metalloproteinase with thrombospondin motifs 8; ADAM TS8; FLJ41712; METH2; METH-2; METH-8; ADAMTS-8; ADAM-TS 8; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 8; ADAM-TS8; |
| Gene ID | 11095 |
| mRNA Refseq | NM_007037 |
| Protein Refseq | NP_008968 |
| MIM | 605175 |
| UniProt ID | Q9UP79 |
| ◆ Recombinant Proteins | ||
| ADAMTS8-281H | Recombinant Human ADAMTS8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ADAMTS8-29H | Recombinant Human ADAMTS8 Protein, MYC/DDK-tagged | +Inquiry |
| ADAMTS8-605HFL | Recombinant Full Length Human ADAMTS8 Protein, C-Flag-tagged | +Inquiry |
| ADAMTS8-3009H | Recombinant Human ADAMTS8, His-tagged | +Inquiry |
| ADAMTS8-309H | Recombinant Human ADAMTS8 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADAMTS8-9027HCL | Recombinant Human ADAMTS8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAMTS8 Products
Required fields are marked with *
My Review for All ADAMTS8 Products
Required fields are marked with *
