Recombinant Human ADARB1 Protein, GST-tagged
| Cat.No. : | ADARB1-315H |
| Product Overview : | Human ADARB1 partial ORF ( AAH65545, 592 a.a. - 701 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | PGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLTP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ADARB1 adenosine deaminase, RNA-specific, B1 [ Homo sapiens ] |
| Official Symbol | ADARB1 |
| Synonyms | ADARB1; adenosine deaminase, RNA-specific, B1; adenosine deaminase, RNA specific, B1 (homolog of rat RED1); double-stranded RNA-specific editase 1; ADAR2; ADAR2a; ADAR2a L1; ADAR2a L2; ADAR2a L3; ADAR2b; ADAR2c; ADAR2d; ADAR2g; DRABA2; DRADA2; hRED1; RED1; RED1 homolog (rat); RNA editase; RED1 homolog; RNA-editing enzyme 1; RNA editing deaminase 1; RNA-editing deaminase 1; dsRNA adenosine deaminase; human dsRNA adenosine deaminase DRADA2; adenosine deaminase, RNA-specific, B1 (RED1 homolog rat); adenosine deaminase, RNA-specific, B1 (homolog of rat RED1); |
| Gene ID | 104 |
| mRNA Refseq | NM_001112 |
| Protein Refseq | NP_001103 |
| MIM | 601218 |
| UniProt ID | P78563 |
| ◆ Recombinant Proteins | ||
| ADARB1-282H | Recombinant Human ADARB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ADARB1-929HF | Recombinant Full Length Human ADARB1 Protein, GST-tagged | +Inquiry |
| ADARB1-167R | Recombinant Rat ADARB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ADARB1-5220H | Recombinant Human ADARB1 protein | +Inquiry |
| ADARB1-315H | Recombinant Human ADARB1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADARB1-28HCL | Recombinant Human ADARB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADARB1 Products
Required fields are marked with *
My Review for All ADARB1 Products
Required fields are marked with *



