Recombinant Human ADARB1 Protein, GST-tagged

• Cat.No.: ADARB1-315H
• Product Overview: Human ADARB1 partial ORF ( AAH65545, 592 a.a. - 701 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region. [provided by RefSeq, Jul 2008]
• Molecular Mass: 37.84 kDa
• AA Sequence: PGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLTP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADARB1 adenosine deaminase, RNA-specific, B1 [ Homo sapiens ]
• Official Symbol: ADARB1
• Synonyms: ADARB1; adenosine deaminase, RNA-specific, B1; adenosine deaminase, RNA specific, B1 (homolog of rat RED1); double-stranded RNA-specific editase 1; ADAR2; ADAR2a; ADAR2a L1; ADAR2a L2; ADAR2a L3; ADAR2b; ADAR2c; ADAR2d; ADAR2g; DRABA2; DRADA2; hRED1; RED1; RED1 homolog (rat); RNA editase; RED1 homolog; RNA-editing enzyme 1; RNA editing deaminase 1; RNA-editing deaminase 1; dsRNA adenosine deaminase; human dsRNA adenosine deaminase DRADA2; adenosine deaminase, RNA-specific, B1 (RED1 homolog rat); adenosine deaminase, RNA-specific, B1 (homolog of rat RED1)
• Gene ID: 104
• mRNA Refseq: NM_001112
• Protein Refseq: NP_001103
• MIM: 601218
• UniProt ID: P78563