Recombinant Human ADARB1 Protein, GST-tagged
Cat.No. : | ADARB1-315H |
Product Overview : | Human ADARB1 partial ORF ( AAH65545, 592 a.a. - 701 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site. Alternative splicing of this gene results in several transcript variants, some of which have been characterized by the presence or absence of an ALU cassette insert and a short or long C-terminal region. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | PGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLTP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADARB1 adenosine deaminase, RNA-specific, B1 [ Homo sapiens ] |
Official Symbol | ADARB1 |
Synonyms | ADARB1; adenosine deaminase, RNA-specific, B1; adenosine deaminase, RNA specific, B1 (homolog of rat RED1); double-stranded RNA-specific editase 1; ADAR2; ADAR2a; ADAR2a L1; ADAR2a L2; ADAR2a L3; ADAR2b; ADAR2c; ADAR2d; ADAR2g; DRABA2; DRADA2; hRED1; RED1; RED1 homolog (rat); RNA editase; RED1 homolog; RNA-editing enzyme 1; RNA editing deaminase 1; RNA-editing deaminase 1; dsRNA adenosine deaminase; human dsRNA adenosine deaminase DRADA2; adenosine deaminase, RNA-specific, B1 (RED1 homolog rat); adenosine deaminase, RNA-specific, B1 (homolog of rat RED1); |
Gene ID | 104 |
mRNA Refseq | NM_001112 |
Protein Refseq | NP_001103 |
MIM | 601218 |
UniProt ID | P78563 |
◆ Recombinant Proteins | ||
ADARB1-450HFL | Recombinant Full Length Human ADARB1 Protein, C-Flag-tagged | +Inquiry |
ADARB1-3775C | Recombinant Chicken ADARB1 | +Inquiry |
ADARB1-314H | Recombinant Human ADARB1 Protein, GST-tagged | +Inquiry |
ADARB1-1147H | Recombinant Human ADARB1 Protein, MYC/DDK-tagged | +Inquiry |
ADARB1-929HF | Recombinant Full Length Human ADARB1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADARB1-28HCL | Recombinant Human ADARB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADARB1 Products
Required fields are marked with *
My Review for All ADARB1 Products
Required fields are marked with *
0
Inquiry Basket