Recombinant Human ADARB1 protein, His-tagged
Cat.No. : | ADARB1-37H |
Product Overview : | Recombinant Human ADARB1 protein(NP_001103)(176-392 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 176-392 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | LFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPALPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFNLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALND |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ADARB1 adenosine deaminase, RNA-specific, B1 [ Homo sapiens ] |
Official Symbol | ADARB1 |
Synonyms | ADARB1; adenosine deaminase, RNA-specific, B1; adenosine deaminase, RNA specific, B1 (homolog of rat RED1); double-stranded RNA-specific editase 1; ADAR2; ADAR2a; ADAR2a L1; ADAR2a L2; ADAR2a L3; ADAR2b; ADAR2c; ADAR2d; ADAR2g; DRABA2; DRADA2; hRED1; RED1; RED1 homolog (rat); RNA editase; RED1 homolog; RNA-editing enzyme 1; RNA editing deaminase 1; RNA-editing deaminase 1; dsRNA adenosine deaminase; human dsRNA adenosine deaminase DRADA2; adenosine deaminase, RNA-specific, B1 (RED1 homolog rat); adenosine deaminase, RNA-specific, B1 (homolog of rat RED1); |
Gene ID | 104 |
mRNA Refseq | NM_001112 |
Protein Refseq | NP_001103 |
MIM | 601218 |
UniProt ID | P78563 |
◆ Recombinant Proteins | ||
ADARB1-314H | Recombinant Human ADARB1 Protein, GST-tagged | +Inquiry |
ADARB1-315H | Recombinant Human ADARB1 Protein, GST-tagged | +Inquiry |
ADARB1-1147H | Recombinant Human ADARB1 Protein, MYC/DDK-tagged | +Inquiry |
ADARB1-282H | Recombinant Human ADARB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADARB1-167R | Recombinant Rat ADARB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADARB1-28HCL | Recombinant Human ADARB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADARB1 Products
Required fields are marked with *
My Review for All ADARB1 Products
Required fields are marked with *
0
Inquiry Basket