Recombinant Human ADARB1 protein, His-tagged

Cat.No. : ADARB1-37H
Product Overview : Recombinant Human ADARB1 protein(NP_001103)(176-392 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 176-392 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : LFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPALPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFNLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALND
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
Concentration : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ADARB1 adenosine deaminase, RNA-specific, B1 [ Homo sapiens ]
Official Symbol ADARB1
Synonyms ADARB1; adenosine deaminase, RNA-specific, B1; adenosine deaminase, RNA specific, B1 (homolog of rat RED1); double-stranded RNA-specific editase 1; ADAR2; ADAR2a; ADAR2a L1; ADAR2a L2; ADAR2a L3; ADAR2b; ADAR2c; ADAR2d; ADAR2g; DRABA2; DRADA2; hRED1; RED1; RED1 homolog (rat); RNA editase; RED1 homolog; RNA-editing enzyme 1; RNA editing deaminase 1; RNA-editing deaminase 1; dsRNA adenosine deaminase; human dsRNA adenosine deaminase DRADA2; adenosine deaminase, RNA-specific, B1 (RED1 homolog rat); adenosine deaminase, RNA-specific, B1 (homolog of rat RED1);
Gene ID 104
mRNA Refseq NM_001112
Protein Refseq NP_001103
MIM 601218
UniProt ID P78563

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADARB1 Products

Required fields are marked with *

My Review for All ADARB1 Products

Required fields are marked with *

0
cart-icon