Recombinant Human ADCY2 Protein, GST-tagged

Cat.No. : ADCY2-327H
Product Overview : Human ADCY2 partial ORF ( NP_065433, 977 a.a. - 1086 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the family of adenylate cyclases, which are membrane-associated enzymes that catalyze the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). This enzyme is insensitive to Ca(2+)/calmodulin, and is stimulated by the G protein beta and gamma subunit complex. [provided by RefSeq, Jul 2008]
Molecular Mass : 37.84 kDa
AA Sequence : GKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQSNVAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADCY2 adenylate cyclase 2 [ Homo sapiens (human) ]
Official Symbol ADCY2
Synonyms ADCY2; adenylate cyclase 2; AC2; HBAC2; adenylate cyclase type 2; 3',5'-cyclic AMP synthetase; ATP pyrophosphate-lyase 2; adenylate cyclase 2 (brain); adenylate cyclase II; adenylate cyclase type II; adenylyl cyclase 2; type II adenylate cyclase; EC 4.6.1.1
Gene ID 108
mRNA Refseq NM_020546
Protein Refseq NP_065433
MIM 103071
UniProt ID Q08462

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADCY2 Products

Required fields are marked with *

My Review for All ADCY2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon