Recombinant Human ADCY2 Protein, GST-tagged

• Cat.No.: ADCY2-327H
• Product Overview: Human ADCY2 partial ORF ( NP_065433, 977 a.a. - 1086 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the family of adenylate cyclases, which are membrane-associated enzymes that catalyze the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). This enzyme is insensitive to Ca(2+)/calmodulin, and is stimulated by the G protein beta and gamma subunit complex. [provided by RefSeq, Jul 2008]
• Molecular Mass: 37.84 kDa
• AA Sequence: GKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQSNVAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADCY2 adenylate cyclase 2 [ Homo sapiens (human) ]
• Official Symbol: ADCY2
• Synonyms: ADCY2; adenylate cyclase 2; AC2; HBAC2; adenylate cyclase type 2; 3',5'-cyclic AMP synthetase; ATP pyrophosphate-lyase 2; adenylate cyclase 2 (brain); adenylate cyclase II; adenylate cyclase type II; adenylyl cyclase 2; type II adenylate cyclase; EC 4.6.1.1
• Gene ID: 108
• mRNA Refseq: NM_020546
• Protein Refseq: NP_065433
• MIM: 103071
• UniProt ID: Q08462