Recombinant Human ADCY5 Protein, GST-tagged

Cat.No. : ADCY5-329H
Product Overview : Human ADCY5 partial ORF ( NP_899200, 1152 a.a. - 1261 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the membrane-bound adenylyl cyclase enzymes. Adenylyl cyclases mediate G protein-coupled receptor signaling through the synthesis of the second messenger cAMP. Activity of the encoded protein is stimulated by the Gs alpha subunit of G protein-coupled receptors and is inhibited by protein kinase A, calcium and Gi alpha subunits. Single nucleotide polymorphisms in this gene may be associated with low birth weight and type 2 diabetes. Alternatively spliced transcript variants that encode different isoforms have been observed for this gene. [provided by RefSeq, Dec 2010]
Molecular Mass : 37.84 kDa
AA Sequence : ADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPLS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADCY5 adenylate cyclase 5 [ Homo sapiens ]
Official Symbol ADCY5
Synonyms ADCY5; adenylate cyclase 5; adenylate cyclase type 5; AC5; adenylyl cyclase 5; adenylate cyclase type V; ATP pyrophosphate-lyase 5;
Gene ID 111
mRNA Refseq NM_001199642
Protein Refseq NP_001186571
MIM 600293
UniProt ID O95622

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADCY5 Products

Required fields are marked with *

My Review for All ADCY5 Products

Required fields are marked with *

0
cart-icon