Recombinant Human ADCY6 Protein, GST-tagged
Cat.No. : | ADCY6-330H |
Product Overview : | Human ADCY6 partial ORF ( AAH64923, 701 a.a. - 800 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the adenylyl cyclase family of proteins, which are required for the synthesis of cyclic AMP. All members of this family have an intracellular N-terminus, a tandem repeat of six transmembrane domains separated by a cytoplasmic loop, and a C-terminal cytoplasmic domain. The two cytoplasmic regions bind ATP and form the catalytic core of the protein. Adenylyl cyclases are important effectors of transmembrane signaling pathways and are regulated by the activity of G protein coupled receptor signaling. This protein belongs to a small subclass of adenylyl cyclase proteins that are functionally related and are inhibited by protein kinase A, calcium ions and nitric oxide. A mutation in this gene is associated with arthrogryposis multiplex congenita. [provided by RefSeq, May 2015] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | YASIFLLLLITVLICAVYSCGSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRSCAARMLNLTPADITACHLQQLNYSLGLDA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADCY6 adenylate cyclase 6 [ Homo sapiens ] |
Official Symbol | ADCY6 |
Synonyms | ADCY6; adenylate cyclase 6; adenylate cyclase type 6; AC6; adenylyl cyclase 6; ATP pyrophosphate-lyase 6; adenylate cyclase type VI; ca(2+)-inhibitable adenylyl cyclase; KIAA0422; DKFZp779F075; |
Gene ID | 112 |
mRNA Refseq | NM_015270 |
Protein Refseq | NP_056085 |
MIM | 600294 |
UniProt ID | O43306 |
◆ Recombinant Proteins | ||
ADCY6-330H | Recombinant Human ADCY6 Protein, GST-tagged | +Inquiry |
ADCY6-3178H | Recombinant Human ADCY6, GST-tagged | +Inquiry |
ADCY6-9409H | Recombinant Human ADCY6 protein, GST-tagged | +Inquiry |
Adcy6-6931M | Recombinant Mouse Adcy6 protein, His & T7-tagged | +Inquiry |
ADCY6-9410H | Recombinant Human ADCY6 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADCY6 Products
Required fields are marked with *
My Review for All ADCY6 Products
Required fields are marked with *