Recombinant Human ADCY6 Protein, GST-tagged

Cat.No. : ADCY6-330H
Product Overview : Human ADCY6 partial ORF ( AAH64923, 701 a.a. - 800 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the adenylyl cyclase family of proteins, which are required for the synthesis of cyclic AMP. All members of this family have an intracellular N-terminus, a tandem repeat of six transmembrane domains separated by a cytoplasmic loop, and a C-terminal cytoplasmic domain. The two cytoplasmic regions bind ATP and form the catalytic core of the protein. Adenylyl cyclases are important effectors of transmembrane signaling pathways and are regulated by the activity of G protein coupled receptor signaling. This protein belongs to a small subclass of adenylyl cyclase proteins that are functionally related and are inhibited by protein kinase A, calcium ions and nitric oxide. A mutation in this gene is associated with arthrogryposis multiplex congenita. [provided by RefSeq, May 2015]
Molecular Mass : 36.63 kDa
AA Sequence : YASIFLLLLITVLICAVYSCGSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRSCAARMLNLTPADITACHLQQLNYSLGLDA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADCY6 adenylate cyclase 6 [ Homo sapiens ]
Official Symbol ADCY6
Synonyms ADCY6; adenylate cyclase 6; adenylate cyclase type 6; AC6; adenylyl cyclase 6; ATP pyrophosphate-lyase 6; adenylate cyclase type VI; ca(2+)-inhibitable adenylyl cyclase; KIAA0422; DKFZp779F075;
Gene ID 112
mRNA Refseq NM_015270
Protein Refseq NP_056085
MIM 600294
UniProt ID O43306

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADCY6 Products

Required fields are marked with *

My Review for All ADCY6 Products

Required fields are marked with *

0
cart-icon
0
compare icon