Recombinant Human ADCY7 Protein, GST-tagged

Cat.No. : ADCY7-331H
Product Overview : Human ADCY7 partial ORF ( NP_001105, 197 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a membrane-bound adenylate cyclase that catalyses the formation of cyclic AMP from ATP and is inhibitable by calcium. The product of this gene is a member of the adenylyl cyclase class-4/guanylyl cyclase enzyme family that is characterized by the presence of twelve membrane-spanning domains in its sequences. Several transcript variants have been observed for this gene, but the full-length natures of only two have been determined so far. [provided by RefSeq, Oct 2013]
Molecular Mass : 34.65 kDa
AA Sequence : HKHQMQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAHISMGMKLAIIERLKEHGDRRCMPDNNFHSLYVKRHQN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADCY7 adenylate cyclase 7 [ Homo sapiens ]
Official Symbol ADCY7
Synonyms ADCY7; adenylate cyclase 7; adenylate cyclase type 7; AC7; KIAA0037; adenylyl cyclase 7; ATP pyrophosphate-lyase 7; adenylate cyclase type VII; FLJ36387;
Gene ID 113
mRNA Refseq NM_001114
Protein Refseq NP_001105
MIM 600385
UniProt ID P51828

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADCY7 Products

Required fields are marked with *

My Review for All ADCY7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon