Recombinant Human ADCY7 Protein, GST-tagged

• Cat.No.: ADCY7-331H
• Product Overview: Human ADCY7 partial ORF ( NP_001105, 197 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a membrane-bound adenylate cyclase that catalyses the formation of cyclic AMP from ATP and is inhibitable by calcium. The product of this gene is a member of the adenylyl cyclase class-4/guanylyl cyclase enzyme family that is characterized by the presence of twelve membrane-spanning domains in its sequences. Several transcript variants have been observed for this gene, but the full-length natures of only two have been determined so far. [provided by RefSeq, Oct 2013]
• Molecular Mass: 34.65 kDa
• AA Sequence: HKHQMQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAHISMGMKLAIIERLKEHGDRRCMPDNNFHSLYVKRHQN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADCY7 adenylate cyclase 7 [ Homo sapiens ]
• Official Symbol: ADCY7
• Synonyms: ADCY7; adenylate cyclase 7; adenylate cyclase type 7; AC7; KIAA0037; adenylyl cyclase 7; ATP pyrophosphate-lyase 7; adenylate cyclase type VII; FLJ36387
• Gene ID: 113
• mRNA Refseq: NM_001114
• Protein Refseq: NP_001105
• MIM: 600385
• UniProt ID: P51828