Recombinant Human ADCY8 Protein, GST-tagged

Cat.No. : ADCY8-332H
Product Overview : Human ADCY8 partial ORF ( NP_001106, 1142 a.a. - 1251 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Adenylate cyclase is a membrane bound enzyme that catalyses the formation of cyclic AMP from ATP. The enzymatic activity is under the control of several hormones, and different polypeptides participate in the transduction of the signal from the receptor to the catalytic moiety. Stimulatory or inhibitory receptors (Rs and Ri) interact with G proteins (Gs and Gi) that exhibit GTPase activity and they modulate the activity of the catalytic subunit of the adenylyl cyclase [provided by RefSeq, Jul 2008]
Molecular Mass : 37.84 kDa
AA Sequence : DQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQSLNRQRQKQLLNENNNTGIIKGHYNRRTLLSPSGTEPGAQAEGTDKSDLP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ADCY8 adenylate cyclase 8 (brain) [ Homo sapiens ]
Official Symbol ADCY8
Synonyms ADCY8; adenylate cyclase 8 (brain); ADCY3; adenylate cyclase type 8; AC8; HBAC1; adenylyl cyclase 8; ATP pyrophosphate-lyase 8; adenylyl cyclase-8, brain; adenylate cyclase type VIII; ca(2+)/calmodulin-activated adenylyl cyclase;
Gene ID 114
mRNA Refseq NM_001115
Protein Refseq NP_001106
MIM 103070
UniProt ID P40145

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADCY8 Products

Required fields are marked with *

My Review for All ADCY8 Products

Required fields are marked with *

0
cart-icon
0
compare icon