Recombinant Human ADCY8 protein, His-tagged
Cat.No. : | ADCY8-7321H |
Product Overview : | Recombinant Human ADCY8 protein(561-715 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sars-CoV-2 |
Source : | E.coli |
Tag : | His |
Protein Length : | 561-715 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | GDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPEDIVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSN |
Gene Name | ADCY8 adenylate cyclase 8 (brain) [ Homo sapiens ] |
Official Symbol | ADCY8 |
Synonyms | ADCY8; adenylate cyclase 8 (brain); ADCY3; adenylate cyclase type 8; AC8; HBAC1; adenylyl cyclase 8; ATP pyrophosphate-lyase 8; adenylyl cyclase-8, brain; adenylate cyclase type VIII; ca(2+)/calmodulin-activated adenylyl cyclase; |
Gene ID | 114 |
mRNA Refseq | NM_001115 |
Protein Refseq | NP_001106 |
MIM | 103070 |
UniProt ID | P40145 |
◆ Recombinant Proteins | ||
NSP1-002V | Recombinant COVID-19 NSP1 protein, His-tagged | +Inquiry |
ADCY8-7321H | Recombinant Human ADCY8 protein, His-tagged | +Inquiry |
NSP1-5741S | Recombinant SARS-CoV-2 NSP1 Protein (Met1-Gly180), N-His tagged | +Inquiry |
NSP1-1027H | Recombinant SARS-CoV-2 NSP1 Protein (H13-G128), His tagged | +Inquiry |
NSP1-0541C | Recombinant COVID-19 NSP1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NSP1 Products
Required fields are marked with *
My Review for All NSP1 Products
Required fields are marked with *
0
Inquiry Basket