Recombinant Human ADCY8 protein, His-tagged
| Cat.No. : | ADCY8-7321H |
| Product Overview : | Recombinant Human ADCY8 protein(561-715 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Sars-CoV-2 |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 561-715 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | GDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPEDIVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSN |
| Gene Name | ADCY8 adenylate cyclase 8 (brain) [ Homo sapiens ] |
| Official Symbol | ADCY8 |
| Synonyms | ADCY8; adenylate cyclase 8 (brain); ADCY3; adenylate cyclase type 8; AC8; HBAC1; adenylyl cyclase 8; ATP pyrophosphate-lyase 8; adenylyl cyclase-8, brain; adenylate cyclase type VIII; ca(2+)/calmodulin-activated adenylyl cyclase; |
| Gene ID | 114 |
| mRNA Refseq | NM_001115 |
| Protein Refseq | NP_001106 |
| MIM | 103070 |
| UniProt ID | P40145 |
| ◆ Recombinant Proteins | ||
| ADCY8-1346M | Recombinant Mouse ADCY8 Protein | +Inquiry |
| ADCY8-332H | Recombinant Human ADCY8 Protein, GST-tagged | +Inquiry |
| ADCY8-7257Z | Recombinant Zebrafish ADCY8 | +Inquiry |
| ADCY8-3182H | Recombinant Human ADCY8, His-tagged | +Inquiry |
| Adcy8-3181M | Recombinant Mouse Adcy8, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADCY8-9020HCL | Recombinant Human ADCY8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADCY8 Products
Required fields are marked with *
My Review for All ADCY8 Products
Required fields are marked with *



