Recombinant Human ADHFE1 protein, His-tagged
Cat.No. : | ADHFE1-9422H |
Product Overview : | Recombinant Human ADHFE1 protein(1-255 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | September 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-255 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MAVSNIRYGAAVTKEVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFMEAIEFAQKGAFDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKIGITSRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKRAVNSTDK |
Gene Name | ADHFE1 alcohol dehydrogenase, iron containing, 1 [ Homo sapiens ] |
Official Symbol | ADHFE1 |
Synonyms | ADHFE1; alcohol dehydrogenase, iron containing, 1; hydroxyacid-oxoacid transhydrogenase, mitochondrial; ADHFe1; FLJ32430; alcohol dehydrogenase 8; Fe-containing alcohol dehydrogenase 1; alcohol dehydrogenase iron-containing protein 1; HOT; ADH8; HMFT2263; MGC48605; |
Gene ID | 137872 |
mRNA Refseq | NM_144650 |
Protein Refseq | NP_653251 |
MIM | 611083 |
UniProt ID | Q8IWW8 |
◆ Recombinant Proteins | ||
ADHFE1-944HF | Recombinant Full Length Human ADHFE1 Protein, GST-tagged | +Inquiry |
ADHFE1-1358M | Recombinant Mouse ADHFE1 Protein | +Inquiry |
ADHFE1-11815Z | Recombinant Zebrafish ADHFE1 | +Inquiry |
ADHFE1-183R | Recombinant Rat ADHFE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADHFE1-346M | Recombinant Mouse ADHFE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADHFE1-32HCL | Recombinant Human ADHFE1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADHFE1 Products
Required fields are marked with *
My Review for All ADHFE1 Products
Required fields are marked with *