Recombinant Human ADHFE1 protein, His-tagged

Cat.No. : ADHFE1-9422H
Product Overview : Recombinant Human ADHFE1 protein(1-255 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability August 18, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-255 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : MAVSNIRYGAAVTKEVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFMEAIEFAQKGAFDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKIGITSRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKRAVNSTDK
Gene Name ADHFE1 alcohol dehydrogenase, iron containing, 1 [ Homo sapiens ]
Official Symbol ADHFE1
Synonyms ADHFE1; alcohol dehydrogenase, iron containing, 1; hydroxyacid-oxoacid transhydrogenase, mitochondrial; ADHFe1; FLJ32430; alcohol dehydrogenase 8; Fe-containing alcohol dehydrogenase 1; alcohol dehydrogenase iron-containing protein 1; HOT; ADH8; HMFT2263; MGC48605;
Gene ID 137872
mRNA Refseq NM_144650
Protein Refseq NP_653251
MIM 611083
UniProt ID Q8IWW8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADHFE1 Products

Required fields are marked with *

My Review for All ADHFE1 Products

Required fields are marked with *

0
cart-icon
0
compare icon