Recombinant Human ADHFE1 protein, His-tagged
| Cat.No. : | ADHFE1-9422H |
| Product Overview : | Recombinant Human ADHFE1 protein(1-255 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | May 24, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-255 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MAVSNIRYGAAVTKEVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFMEAIEFAQKGAFDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKIGITSRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKRAVNSTDK |
| Gene Name | ADHFE1 alcohol dehydrogenase, iron containing, 1 [ Homo sapiens ] |
| Official Symbol | ADHFE1 |
| Synonyms | ADHFE1; alcohol dehydrogenase, iron containing, 1; hydroxyacid-oxoacid transhydrogenase, mitochondrial; ADHFe1; FLJ32430; alcohol dehydrogenase 8; Fe-containing alcohol dehydrogenase 1; alcohol dehydrogenase iron-containing protein 1; HOT; ADH8; HMFT2263; MGC48605; |
| Gene ID | 137872 |
| mRNA Refseq | NM_144650 |
| Protein Refseq | NP_653251 |
| MIM | 611083 |
| UniProt ID | Q8IWW8 |
| ◆ Recombinant Proteins | ||
| ADHFE1-183R | Recombinant Rat ADHFE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ADHFE1-9422H | Recombinant Human ADHFE1 protein, His-tagged | +Inquiry |
| ADHFE1-944HF | Recombinant Full Length Human ADHFE1 Protein, GST-tagged | +Inquiry |
| ADHFE1-355H | Recombinant Human ADHFE1 Protein, GST-tagged | +Inquiry |
| ADHFE1-346M | Recombinant Mouse ADHFE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADHFE1-32HCL | Recombinant Human ADHFE1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADHFE1 Products
Required fields are marked with *
My Review for All ADHFE1 Products
Required fields are marked with *
