Recombinant Human ADIPOQ Protein, GST-tagged
Cat.No. : | ADIPOQ-392H |
Product Overview : | Human ADIPOQ partial ORF ( NP_004788, 111 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Apr 2010] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | YRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADIPOQ adiponectin, C1Q and collagen domain containing [ Homo sapiens ] |
Official Symbol | ADIPOQ |
Synonyms | ADIPOQ; adiponectin, C1Q and collagen domain containing; ACDC, adipocyte, C1Q and collagen domain containing; adiponectin; ACRP30; AdipoQ; adipose most abundant gene transcript 1; apM1; GBP28; gelatin-binding protein 28; adipose specific collagen-like factor; 30 kDa adipocyte complement-related protein; adipocyte complement-related 30 kDa protein; adipose most abundant gene transcript 1 protein; ACDC; ADPN; APM1; APM-1; ADIPQTL1; |
Gene ID | 9370 |
mRNA Refseq | NM_001177800 |
Protein Refseq | NP_001171271 |
MIM | 605441 |
UniProt ID | Q15848 |
◆ Recombinant Proteins | ||
ADIPOQ-856H | Recombinant Human ADIPOQ protein, Flag-tagged | +Inquiry |
Adipoq-204M | Recombinant Mouse Adipoq protein, His-tagged | +Inquiry |
ADIPOQ-218P | Recombinant Porcine ADIPOQ, Flag-tagged | +Inquiry |
Adipoq-7149M | Recombinant Mouse Adipoq Protein | +Inquiry |
Adipoq-7152M | Active Recombinant Mouse Adipoq Protein | +Inquiry |
◆ Native Proteins | ||
ADIPOQ-215H | Native Human Adiponectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADIPOQ-1526HCL | Recombinant Human ADIPOQ cell lysate | +Inquiry |
ADIPOQ-2209MCL | Recombinant Mouse ADIPOQ cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADIPOQ Products
Required fields are marked with *
My Review for All ADIPOQ Products
Required fields are marked with *