Active Recombinant Human ADIPOQ Protein
Cat.No. : | ADIPOQ-01H |
Product Overview : | Recombinant Human ADIPOQ Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | The globular subunit of adipocyte complement-related protein of 30 kDa (ACRP-30) is a naturally occurring cleavage product of adiponectin, a protein made exclusively by adipocytes. ACRP-30 is an abundant serum protein and plays an important role in hyperglycemia, insulin resistance, and fatty acid oxidation. ACRP-30 signals through adiponectin receptor 1 (AdipoR1) and adiponectin receptor 2 (AdipoR2). |
Bio-activity : | Inhibition of M1 Cell Proliferation, ED50≤2,000 ng/mL; ≥500 units/mg |
Molecular Mass : | Monomer, 16.7 kDa (145 aa) |
AA Sequence : | MKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥90%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 0.5 mM DTT, pH 7.5 |
Reconstitution : | Sterile 10 mM sodium phosphate, 0.5 mM DTT, pH 7.5 at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | ADIPOQ adiponectin, C1Q and collagen domain containing [ Homo sapiens (human) ] |
Official Symbol | ADIPOQ |
Synonyms | ADIPOQ; adiponectin, C1Q and collagen domain containing; ACDC, adipocyte, C1Q and collagen domain containing; adiponectin; ACRP30; AdipoQ; adipose most abundant gene transcript 1; apM1; GBP28; gelatin-binding protein 28; adipose specific collagen-like factor; 30 kDa adipocyte complement-related protein; adipocyte complement-related 30 kDa protein; adipose most abundant gene transcript 1 protein; ACDC; ADPN; APM1; APM-1; ADIPQTL1; |
Gene ID | 9370 |
mRNA Refseq | NM_001177800 |
Protein Refseq | NP_001171271 |
MIM | 605441 |
UniProt ID | Q15848 |
◆ Recombinant Proteins | ||
ADIPOQ-693H | Recombinant Human ADIPOQ, 145aa | +Inquiry |
ADIPOQ-7301H | Recombinant Human ADIPOQ protein, Fc-tagged | +Inquiry |
Adipoq-443A | Active Recombinant Mouse Adipoq Protein (227 aa) | +Inquiry |
Adipoq-502R | Active Recombinant Rat Adipoq Protein | +Inquiry |
Adipoq-500M | Recombinant Mouse Adipoq Protein | +Inquiry |
◆ Native Proteins | ||
ADIPOQ-215H | Native Human Adiponectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADIPOQ-2209MCL | Recombinant Mouse ADIPOQ cell lysate | +Inquiry |
ADIPOQ-1526HCL | Recombinant Human ADIPOQ cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADIPOQ Products
Required fields are marked with *
My Review for All ADIPOQ Products
Required fields are marked with *
0
Inquiry Basket