Recombinant Human ADIPOR1, GST-tagged
Cat.No. : | ADIPOR1-625H |
Product Overview : | Human ADIPOR1 full-length ORF ( NP_057083.2, 1 a.a. - 375 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. |
Molecular Mass : | 69 kDa |
AA Sequence : | MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHH AMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLF LGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLY YSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADIPOR1 adiponectin receptor 1 [ Homo sapiens (human) ] |
Official Symbol | ADIPOR1 |
Synonyms | ADIPOR1; CGI45; PAQR1; ACDCR1; CGI-45; TESBP1A; adiponectin receptor 1; progestin and adipoQ receptor family member I |
Gene ID | 51094 |
mRNA Refseq | NM_015999 |
Protein Refseq | NP_057083 |
MIM | 607945 |
UniProt ID | Q96A54 |
Chromosome Location | 1q32.1 |
Pathway | AMPK signaling; Adipocytokine signaling pathway |
Function | hormone binding; identical protein binding; protein heterodimerization activity |
◆ Recombinant Proteins | ||
ADIPOR1-12HF | Recombinant Full Length Human ADIPOR1 Protein, GST-tagged | +Inquiry |
Adipor1-1541M | Recombinant Mouse Adipor1 Protein, Myc/DDK-tagged | +Inquiry |
ADIPOR1-2351H | Recombinant Human ADIPOR1 protein, His-Flag-tagged | +Inquiry |
ADIPOR1-1354H | Recombinant Human ADIPOR1 Transmembrane protein, His-Flag-tagged | +Inquiry |
ADIPOR1-3199H | Recombinant Human ADIPOR1, His-tagged, MBP tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADIPOR1 Products
Required fields are marked with *
My Review for All ADIPOR1 Products
Required fields are marked with *