Recombinant Human ADORA3 Protein, GST-tagged
Cat.No. : | ADORA3-372H |
Product Overview : | Human ADORA3 partial ORF ( AAH29831, 121 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that belongs to the family of adenosine receptors, which are G-protein-coupled receptors that are involved in a variety of intracellular signaling pathways and physiological functions. The receptor encoded by this gene mediates a sustained cardioprotective function during cardiac ischemia, it is involved in the inhibition of neutrophil degranulation in neutrophil-mediated tissue injury, it has been implicated in both neuroprotective and neurodegenerative effects, and it may also mediate both cell proliferation and cell death. Alternative splicing results in multiple transcript variants. This gene shares its 5' terminal exon with some transcripts from overlapping GeneID:57413, which encodes an immunoglobulin domain-containing protein. [provided by RefSeq, Nov 2014] |
Molecular Mass : | 37.18 kDa |
AA Sequence : | VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGRE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADORA3 adenosine A3 receptor [ Homo sapiens ] |
Official Symbol | ADORA3 |
Synonyms | ADORA3; adenosine A3 receptor; adenosine receptor A3; AD026; A3AR; bA552M11.5; RP11-552M11.7; |
Gene ID | 140 |
mRNA Refseq | NM_000677 |
Protein Refseq | NP_000668 |
MIM | 600445 |
UniProt ID | P33765 |
◆ Recombinant Proteins | ||
ADORA3-191R | Recombinant Rat ADORA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADORA3-83R | Recombinant Rhesus Macaque ADORA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADORA3-371H | Recombinant Human ADORA3 Protein | +Inquiry |
ADORA3-372H | Recombinant Human ADORA3 Protein, GST-tagged | +Inquiry |
ADORA3-968HF | Recombinant Full Length Human ADORA3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADORA3-12HCL | Recombinant Human ADORA3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADORA3 Products
Required fields are marked with *
My Review for All ADORA3 Products
Required fields are marked with *