Recombinant Human ADRBK2 protein, His-tagged
Cat.No. : | ADRBK2-3533H |
Product Overview : | Recombinant Human ADRBK2 protein(1-387 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-387 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MADLEAVLADVSYLMAMEKSKATPAARASKRIVLPEPSIRSVMQKYLAERNEITFDKIFNQKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSCSHPFSKQAVEHVQSHLSKKQVTSTLFQPYIEEICESLRGDIFQKFMESDKFTRFCQWKNVELNIHLTMNEFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATEIILGLEHMHNRFVVYRDLKPANILLDEHGHARISDLGLACDFSKKKPHASVGTHGYMAPEVLQKGTAYDSSADWFSLGCMLFKLLRG |
Gene Name | ADRBK2 adrenergic, beta, receptor kinase 2 [ Homo sapiens ] |
Official Symbol | ADRBK2 |
Synonyms | ADRBK2; adrenergic, beta, receptor kinase 2; beta-adrenergic receptor kinase 2; BARK2; GRK3; beta-ARK-2; G-protein-coupled receptor kinase 3; |
Gene ID | 157 |
mRNA Refseq | NM_005160 |
Protein Refseq | NP_005151 |
MIM | 109636 |
UniProt ID | P35626 |
◆ Recombinant Proteins | ||
ADRBK2-547R | Recombinant Rat ADRBK2 Protein | +Inquiry |
ADRBK2-203R | Recombinant Rat ADRBK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADRBK2-385H | Active Recombinant Human ADRBK2 Protein, GST-tagged | +Inquiry |
ADRBK2-7175Z | Recombinant Zebrafish ADRBK2 | +Inquiry |
ADRBK2-969HF | Recombinant Full Length Human ADRBK2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADRBK2-13HCL | Recombinant Human ADRBK2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADRBK2 Products
Required fields are marked with *
My Review for All ADRBK2 Products
Required fields are marked with *