Recombinant Human ADSL Protein, GST-tagged
Cat.No. : | ADSL-389H |
Product Overview : | Human ADSL full-length ORF ( NP_000017.1, 1 a.a. - 484 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the lyase 1 family. It is an essential enzyme involved in purine metabolism, and catalyzes two non-sequential reactions in the de novo purine biosynthetic pathway: the conversion of succinylaminoimidazole carboxamide ribotide (SAICAR) to aminoimidazole carboxamide ribotide (AICAR) and the conversion of adenylosuccinate (S-AMP) to adenosine monophosphate (AMP). Mutations in this gene are associated with adenylosuccinase deficiency (ADSLD), a disorder marked with psychomotor retardation, epilepsy or autistic features. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2015] |
Molecular Mass : | 81.3 kDa |
AA Sequence : | MAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVMKVKAELCL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ADSL adenylosuccinate lyase [ Homo sapiens ] |
Official Symbol | ADSL |
Synonyms | ADSL; adenylosuccinate lyase; adenylosuccinase; ASL; AMPS; ASASE; |
Gene ID | 158 |
mRNA Refseq | NM_000026 |
Protein Refseq | NP_000017 |
MIM | 608222 |
UniProt ID | P30566 |
◆ Recombinant Proteins | ||
Adsl-3187M | Recombinant Mouse Adsl, His-tagged | +Inquiry |
ADSL-2494H | Recombinant Human ADSL protein, His-tagged | +Inquiry |
ADSL-26897TH | Recombinant Human ADSL, His-tagged | +Inquiry |
ADSL-369M | Recombinant Mouse ADSL Protein, His (Fc)-Avi-tagged | +Inquiry |
ADSL-9449H | Recombinant Human ADSL, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADSL-8995HCL | Recombinant Human ADSL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADSL Products
Required fields are marked with *
My Review for All ADSL Products
Required fields are marked with *
0
Inquiry Basket