Recombinant Human AES Protein, GST-tagged
| Cat.No. : | AES-398H | 
| Product Overview : | Human AES partial ORF ( NP_001121, 2 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] | 
| Molecular Mass : | 37.73 kDa | 
| AA Sequence : | MFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIER | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | AES amino-terminal enhancer of split [ Homo sapiens ] | 
| Official Symbol | AES | 
| Synonyms | AES; amino-terminal enhancer of split; GRG5; TLE5; gp130-associated protein GAM; GRG; ESP1; AES-1; AES-2; | 
| Gene ID | 166 | 
| mRNA Refseq | NM_001130 | 
| Protein Refseq | NP_001121 | 
| MIM | 600188 | 
| UniProt ID | Q08117 | 
| ◆ Recombinant Proteins | ||
| AES-544H | Recombinant Human AES Protein, MYC/DDK-tagged | +Inquiry | 
| AES-10734Z | Recombinant Zebrafish AES | +Inquiry | 
| AES-1497H | Recombinant Human AES Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| AES-552R | Recombinant Rat AES Protein | +Inquiry | 
| AES-2489H | Recombinant Human AES protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| AES-8991HCL | Recombinant Human AES 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AES Products
Required fields are marked with *
My Review for All AES Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            