Recombinant Human AES Protein, GST-tagged
Cat.No. : | AES-398H |
Product Overview : | Human AES partial ORF ( NP_001121, 2 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | MFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIER |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AES amino-terminal enhancer of split [ Homo sapiens ] |
Official Symbol | AES |
Synonyms | AES; amino-terminal enhancer of split; GRG5; TLE5; gp130-associated protein GAM; GRG; ESP1; AES-1; AES-2; |
Gene ID | 166 |
mRNA Refseq | NM_001130 |
Protein Refseq | NP_001121 |
MIM | 600188 |
UniProt ID | Q08117 |
◆ Recombinant Proteins | ||
AES-28533TH | Recombinant Human AES, His-tagged | +Inquiry |
AES-32C | Recombinant Cynomolgus Monkey AES Protein, His (Fc)-Avi-tagged | +Inquiry |
AES-397H | Recombinant Human AES Protein, GST-tagged | +Inquiry |
AES-985HF | Recombinant Full Length Human AES Protein, GST-tagged | +Inquiry |
AES-552R | Recombinant Rat AES Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AES-8991HCL | Recombinant Human AES 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AES Products
Required fields are marked with *
My Review for All AES Products
Required fields are marked with *
0
Inquiry Basket