Recombinant Human AFF1 Protein, His tagged

Cat.No. : AFF1-406H
Product Overview : Recombinant Human AFF1 Protein with His tag was expressed in Wheat germ cell free in vitro.
Availability August 25, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat germ cell free in vitro
Tag : His
Protein Length : 71-170 aa
Description : This gene encodes a member of the AF4/ lymphoid nuclear protein related to the Fragile X E syndrome (FRAXE) family of proteins, which have been implicated in human childhood lymphoblastic leukemia, fragile chromosome X intellectual disability, and ataxia. It is the prevalent mixed-lineage leukemia fusion gene associated with spontaneous acute lymphoblastic leukemia. Members of this family have three conserved domains: an N-terminal homology domain, an AF4/ lymphoid nuclear protein domain, and a C-terminal homology domain. The protein functions as a regulator of RNA polymerase II-mediated transcription through elongation and chromatin remodeling functions. Through RNA interference screens, this gene has been shown to promote the expression of CD133, a plasma membrane glycoprotein required for leukemia cell survival. Alternative splicing results in multiple transcript variants.
Form : Sterile 50mM Tris, pH 8.0, 10mM Reduced Glutathione
Molecular Mass : 12 kDa
AASequence : MHHHHHHHHHHLSTKSHTHRLDASENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFG
Endotoxin : < 1.0 EU/μg of the protein by the LAL method.
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.22 mg/mL by Bradford
Gene Name AFF1 AF4/FMR2 family, member 1 [ Homo sapiens (human) ]
Official Symbol AFF1
Synonyms AFF1; AF4/FMR2 family, member 1; MLLT2, myeloid/lymphoid or mixed lineage leukemia (trithorax (Drosophila) homolog); translocated to, 2, PBM1, pre B cell monocytic leukemia partner 1; AF4/FMR2 family member 1; AF 4; AF4; protein AF-4; proto-oncogene AF4; pre-B-cell monocytic leukemia partner 1; ALL1-fused gene from chromosome 4 protein; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 2; PBM1; MLLT2; MGC134969;
Gene ID 4299
mRNA Refseq NM_001166693
Protein Refseq NP_001160165
MIM 159557
UniProt ID P51825

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AFF1 Products

Required fields are marked with *

My Review for All AFF1 Products

Required fields are marked with *

0
cart-icon
0
compare icon