Recombinant Human AFF1 Protein, His tagged
| Cat.No. : | AFF1-406H |
| Product Overview : | Recombinant Human AFF1 Protein with His tag was expressed in Wheat germ cell free in vitro. |
| Availability | August 25, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat germ cell free in vitro |
| Tag : | His |
| Protein Length : | 71-170 aa |
| Description : | This gene encodes a member of the AF4/ lymphoid nuclear protein related to the Fragile X E syndrome (FRAXE) family of proteins, which have been implicated in human childhood lymphoblastic leukemia, fragile chromosome X intellectual disability, and ataxia. It is the prevalent mixed-lineage leukemia fusion gene associated with spontaneous acute lymphoblastic leukemia. Members of this family have three conserved domains: an N-terminal homology domain, an AF4/ lymphoid nuclear protein domain, and a C-terminal homology domain. The protein functions as a regulator of RNA polymerase II-mediated transcription through elongation and chromatin remodeling functions. Through RNA interference screens, this gene has been shown to promote the expression of CD133, a plasma membrane glycoprotein required for leukemia cell survival. Alternative splicing results in multiple transcript variants. |
| Form : | Sterile 50mM Tris, pH 8.0, 10mM Reduced Glutathione |
| Molecular Mass : | 12 kDa |
| AASequence : | MHHHHHHHHHHLSTKSHTHRLDASENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFG |
| Endotoxin : | < 1.0 EU/μg of the protein by the LAL method. |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.22 mg/mL by Bradford |
| Gene Name | AFF1 AF4/FMR2 family, member 1 [ Homo sapiens (human) ] |
| Official Symbol | AFF1 |
| Synonyms | AFF1; AF4/FMR2 family, member 1; MLLT2, myeloid/lymphoid or mixed lineage leukemia (trithorax (Drosophila) homolog); translocated to, 2, PBM1, pre B cell monocytic leukemia partner 1; AF4/FMR2 family member 1; AF 4; AF4; protein AF-4; proto-oncogene AF4; pre-B-cell monocytic leukemia partner 1; ALL1-fused gene from chromosome 4 protein; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 2; PBM1; MLLT2; MGC134969; |
| Gene ID | 4299 |
| mRNA Refseq | NM_001166693 |
| Protein Refseq | NP_001160165 |
| MIM | 159557 |
| UniProt ID | P51825 |
| ◆ Recombinant Proteins | ||
| AFF1-1732H | Recombinant Human AFF1 protein, His & T7-tagged | +Inquiry |
| AFF1-405H | Recombinant Human AFF1 Protein, GST-tagged | +Inquiry |
| AFF1-406H | Recombinant Human AFF1 Protein, His tagged | +Inquiry |
| Aff1-3230M | Recombinant Mouse Aff1, His-tagged | +Inquiry |
| AFF1-26446TH | Recombinant Human AFF1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AFF1 Products
Required fields are marked with *
My Review for All AFF1 Products
Required fields are marked with *


