Recombinant Human AFF1 Protein, His tagged

• Cat.No.: AFF1-406H
• Product Overview: Recombinant Human AFF1 Protein with His tag was expressed in Wheat germ cell free in vitro.

Specification

• Species: Human
• Source: Wheat germ cell free in vitro
• Tag: His
• Protein Length: 71-170 aa
• Description: This gene encodes a member of the AF4/ lymphoid nuclear protein related to the Fragile X E syndrome (FRAXE) family of proteins, which have been implicated in human childhood lymphoblastic leukemia, fragile chromosome X intellectual disability, and ataxia. It is the prevalent mixed-lineage leukemia fusion gene associated with spontaneous acute lymphoblastic leukemia. Members of this family have three conserved domains: an N-terminal homology domain, an AF4/ lymphoid nuclear protein domain, and a C-terminal homology domain. The protein functions as a regulator of RNA polymerase II-mediated transcription through elongation and chromatin remodeling functions. Through RNA interference screens, this gene has been shown to promote the expression of CD133, a plasma membrane glycoprotein required for leukemia cell survival. Alternative splicing results in multiple transcript variants.
• Form: Sterile 50mM Tris, pH 8.0, 10mM Reduced Glutathione
• Molecular Mass: 12 kDa
• AASequence: MHHHHHHHHHHLSTKSHTHRLDASENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFG
• Endotoxin: < 1.0 EU/μg of the protein by the LAL method.
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.22 mg/mL by Bradford

Gene Information

• Gene Name: AFF1 AF4/FMR2 family, member 1 [ Homo sapiens (human) ]
• Official Symbol: AFF1
• Synonyms: AFF1; AF4/FMR2 family, member 1; MLLT2, myeloid/lymphoid or mixed lineage leukemia (trithorax (Drosophila) homolog); translocated to, 2, PBM1, pre B cell monocytic leukemia partner 1; AF4/FMR2 family member 1; AF 4; AF4; protein AF-4; proto-oncogene AF4; pre-B-cell monocytic leukemia partner 1; ALL1-fused gene from chromosome 4 protein; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 2; PBM1; MLLT2; MGC134969
• Gene ID: 4299
• mRNA Refseq: NM_001166693
• Protein Refseq: NP_001160165
• MIM: 159557
• UniProt ID: P51825