Recombinant Human AGA Protein (206-346 aa), His-SUMO-tagged
| Cat.No. : | AGA-310H |
| Product Overview : | Recombinant Human AGA Protein (206-346 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 206-346 aa |
| Description : | Cleaves the GlcNAc-Asn bond which joins oligosaccharides to the peptide of asparagine-linked glycoproteins. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 31.1 kDa |
| AA Sequence : | TIGMVVIHKTGHIAAGTSTNGIKFKIHGRVGDSPIPGAGAYADDTAGAAAATGNGDILMRFLPSYQAVEYMRRGEDPTIACQKVISRIQKHFPEFFGAVICANVTGSYGAACNKLSTFTQFSFMVYNSEKNQPTEEKVDCI |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | AGA aspartylglucosaminidase [ Homo sapiens ] |
| Official Symbol | AGA |
| Synonyms | AGA; aspartylglucosaminidase; ASRG; GA; AGU; |
| Gene ID | 175 |
| mRNA Refseq | NM_000027 |
| Protein Refseq | NP_000018 |
| MIM | 613228 |
| UniProt ID | P20933 |
| ◆ Recombinant Proteins | ||
| AGA-33C | Recombinant Cynomolgus Monkey AGA Protein, His (Fc)-Avi-tagged | +Inquiry |
| AGA-135H | Active Recombinant Human AGA protein, His-tagged | +Inquiry |
| AGA-310H | Recombinant Human AGA Protein (206-346 aa), His-SUMO-tagged | +Inquiry |
| AGA-994HF | Recombinant Full Length Human AGA Protein, GST-tagged | +Inquiry |
| Aga-550M | Recombinant Mouse Aga Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AGA-784HCL | Recombinant Human AGA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGA Products
Required fields are marked with *
My Review for All AGA Products
Required fields are marked with *
