Recombinant Human AGAP3 Protein, GST-Tagged
Cat.No. : | AGAP3-0009H |
Product Overview : | Human CENTG3 partial ORF (NP_114152, 241 a.a. - 338 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an essential component of the N-methyl-D-aspartate (NMDA) receptor signaling complex which mediates long-term potentiation in synapses by linking activation of NMDA receptor to alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor trafficking. The encoded protein contains an N-terminal GTPase-like domain, a pleckstrin homology domain, an ArfGAP domain and several C-terminal ankryn repeat domains. [provided by RefSeq, Apr 2017] |
Molecular Mass : | 36.52 kDa |
AA Sequence : | VFQDVAQKVVALRKKQQLAIGPCKSLPNSPSHSAVSAASIPAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRIETIAASSTPTPIRKQSKRRSNI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AGAP3 ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [ Homo sapiens ] |
Official Symbol | AGAP3 |
Synonyms | AGAP3; ArfGAP with GTPase domain, ankyrin repeat and PH domain 3; centaurin, gamma 3, CENTG3; arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3; centaurin-gamma-3; centaurin, gamma 3; CRAM-associated GTPase; MR1-interacting protein; CRMP (collapsin response mediator protein) associated; CRAG; AGAP-3; CENTG3; MRIP-1; cnt-g3; FLJ16146; FLJ34452; |
Gene ID | 116988 |
mRNA Refseq | NM_001042535 |
Protein Refseq | NP_001036000 |
MIM | 616813 |
UniProt ID | Q96P47 |
◆ Recombinant Proteins | ||
AGAP3-301203H | Recombinant Human AGAP3 protein, GST-tagged | +Inquiry |
AGAP3-541H | Recombinant Human AGAP3 Protein, MYC/DDK-tagged | +Inquiry |
AGAP3-2744H | Recombinant Human AGAP3 protein, His-tagged | +Inquiry |
AGAP3-2745H | Recombinant Human AGAP3 protein, GST-tagged | +Inquiry |
Agap3-1551M | Recombinant Mouse Agap3 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGAP3 Products
Required fields are marked with *
My Review for All AGAP3 Products
Required fields are marked with *
0
Inquiry Basket