Recombinant Human AGL protein, His-tagged
| Cat.No. : | AGL-4533H |
| Product Overview : | Recombinant Human AGL protein(258-424 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 258-424 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | SCDVAEGKYKEKGIPALIENDHHMNSIRKIIWEDIFPKLKLWEFFQVDVNKAVEQFRRLLTQENRRVTKSDPNQHLTIIQDPEYRRFGCTVDMNIALTTFIPHDKGPAAIEECCNWFHKRMEELNSEKHRLINYHQEQAVNCLLGNVFYERLAGHGPKLGPVTRKHP |
| Gene Name | AGL amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase [ Homo sapiens ] |
| Official Symbol | AGL |
| Synonyms | AGL; amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase; amylo 1, 6 glucosidase, 4 alpha glucanotransferase; glycogen debranching enzyme; glycogen storage disease type III; glycogen debrancher; amylo-1, 6-glucosidase, 4-alpha-glucanotransferase; GDE; |
| Gene ID | 178 |
| mRNA Refseq | NM_000028 |
| Protein Refseq | NP_000019 |
| MIM | 610860 |
| UniProt ID | P35573 |
| ◆ Recombinant Proteins | ||
| AGL-290H | Recombinant Human AGL Protein, His (Fc)-Avi-tagged | +Inquiry |
| AGL-4533H | Recombinant Human AGL protein, His-tagged | +Inquiry |
| AGL-2755H | Recombinant Human AGL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| AGL-2159H | Recombinant Human AGL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| AGL-7920H | Recombinant Human AGL protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AGL-8979HCL | Recombinant Human AGL 293 Cell Lysate | +Inquiry |
| AGL-8980HCL | Recombinant Human AGL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGL Products
Required fields are marked with *
My Review for All AGL Products
Required fields are marked with *
