Recombinant Human AGO2 Protein

• Cat.No.: AGO2-02H
• Product Overview: Recombinant Human AGO2 Protein was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Description: This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.
• Form: Liquid. In 20 mM Tris-HCl, 1 M NaCl, pH8.0, with 10% glycerol.
• Molecular Mass: ~30.4 kDa
• AA Sequence: CEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCKYAQGADS
• Purity: >90%
• Storage: Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.24 mg/ml
• Official Full Name: Argonaute RISC catalytic component 2

Gene Information

• Gene Name: AGO2 argonaute RISC catalytic component 2 [ Homo sapiens (human) ]
• Official Symbol: AGO2
• Synonyms: PPD; Q10; CASC7; EIF2C2; LESKRES; LINC00980
• Gene ID: 27161
• mRNA Refseq: NM_001164623
• Protein Refseq: NP_001158095
• MIM: 606229
• UniProt ID: Q9UKV8