Recombinant Human AGO2 Protein
Cat.No. : | AGO2-02H |
Product Overview : | Recombinant Human AGO2 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | Liquid. In 20 mM Tris-HCl, 1 M NaCl, pH8.0, with 10% glycerol. |
Molecular Mass : | ~30.4 kDa |
AA Sequence : | CEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCKYAQGADS |
Purity : | >90% |
Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.24 mg/ml |
Official Full Name : | Argonaute RISC catalytic component 2 |
Gene Name | AGO2 argonaute RISC catalytic component 2 [ Homo sapiens (human) ] |
Official Symbol | AGO2 |
Synonyms | PPD; Q10; CASC7; EIF2C2; LESKRES; LINC00980 |
Gene ID | 27161 |
mRNA Refseq | NM_001164623 |
Protein Refseq | NP_001158095 |
MIM | 606229 |
UniProt ID | Q9UKV8 |
◆ Recombinant Proteins | ||
AGO2-526H | Recombinant Human AGO2 Protein, MYC/DDK-tagged | +Inquiry |
AGO2-1728H | Recombinant Human AGO2 Protein (517-818 aa), His-tagged | +Inquiry |
EIF2C2-2180H | Active Recombinant Human EIF2C2, His-tagged | +Inquiry |
AGO2-2180H | Recombinant Human AGO2, His-tagged | +Inquiry |
AGO2-8477Z | Recombinant Zebrafish AGO2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGO2-714HCL | Recombinant Human AGO2 cell lysate | +Inquiry |
AGO2-576MCL | Recombinant Mouse AGO2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGO2 Products
Required fields are marked with *
My Review for All AGO2 Products
Required fields are marked with *