Recombinant Human AGO2 Protein

Cat.No. : AGO2-02H
Product Overview : Recombinant Human AGO2 Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.
Form : Liquid. In 20 mM Tris-HCl, 1 M NaCl, pH8.0, with 10% glycerol.
Molecular Mass : ~30.4 kDa
AA Sequence : CEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCKYAQGADS
Purity : >90%
Storage : Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
Concentration : 0.24 mg/ml
Official Full Name : Argonaute RISC catalytic component 2
Gene Name AGO2 argonaute RISC catalytic component 2 [ Homo sapiens (human) ]
Official Symbol AGO2
Synonyms PPD; Q10; CASC7; EIF2C2; LESKRES; LINC00980
Gene ID 27161
mRNA Refseq NM_001164623
Protein Refseq NP_001158095
MIM 606229
UniProt ID Q9UKV8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AGO2 Products

Required fields are marked with *

My Review for All AGO2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon