Recombinant Human AGPAT2 Protein, GST-tagged
Cat.No. : | AGPAT2-429H |
Product Overview : | Human AGPAT2 partial ORF ( NP_006403, 51 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in this gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 33.11 kDa |
AA Sequence : | RHGGRTVENMSIIGWFVRSFKYFYGLRFEVRDPRRLQEARPCVIVSNHQSILDMMGLMEVLPERCVQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AGPAT2 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) [ Homo sapiens ] |
Official Symbol | AGPAT2 |
Synonyms | AGPAT2; 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta); Berardinelli Seip congenital lipodystrophy, BSCL; 1-acyl-sn-glycerol-3-phosphate acyltransferase beta; LPAAT beta; 1-AGPAT 2; 1-AGP acyltransferase 2; lysophosphatidic acid acyltransferase beta; lysophosphatidic acid acyltransferase-beta; 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase-beta); BSCL; BSCL1; LPAAB; 1-AGPAT2; LPAAT-beta; |
Gene ID | 10555 |
mRNA Refseq | NM_001012727 |
Protein Refseq | NP_001012745 |
MIM | 603100 |
UniProt ID | O15120 |
◆ Recombinant Proteins | ||
AGPAT2-930HF | Recombinant Full Length Human AGPAT2 Protein, GST-tagged | +Inquiry |
AGPAT2-1064H | Recombinant Human AGPAT2 protein, GST-tagged | +Inquiry |
AGPAT2-4827Z | Recombinant Zebrafish AGPAT2 | +Inquiry |
RFL25135MF | Recombinant Full Length Mouse 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase Beta(Agpat2) Protein, His-Tagged | +Inquiry |
AGPAT2-3573H | Recombinant Human AGPAT2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGPAT2-8977HCL | Recombinant Human AGPAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGPAT2 Products
Required fields are marked with *
My Review for All AGPAT2 Products
Required fields are marked with *