Recombinant Human AGPAT2 protein, His-tagged
| Cat.No. : | AGPAT2-3573H |
| Product Overview : | Recombinant Human AGPAT2 protein, fused to His tag, was expressed in E. coli. |
| Availability | September 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | VPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPAQ |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | AGPAT2 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) [ Homo sapiens ] |
| Official Symbol | AGPAT2 |
| Synonyms | AGPAT2; 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta); Berardinelli Seip congenital lipodystrophy , BSCL; 1-acyl-sn-glycerol-3-phosphate acyltransferase beta; LPAAT beta; 1-AGPAT 2; 1-AGP acyltransferase 2; lysophosphatidic acid acyltransferase beta; lysophosphatidic acid acyltransferase-beta; 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase-beta); BSCL; BSCL1; LPAAB; 1-AGPAT2; LPAAT-beta; |
| Gene ID | 10555 |
| mRNA Refseq | NM_001012727 |
| Protein Refseq | NP_001012745 |
| MIM | 603100 |
| UniProt ID | O15120 |
| ◆ Recombinant Proteins | ||
| AGPAT2-930HF | Recombinant Full Length Human AGPAT2 Protein, GST-tagged | +Inquiry |
| AGPAT2-428H | Recombinant Human AGPAT2 Protein, GST-tagged | +Inquiry |
| AGPAT2-1064H | Recombinant Human AGPAT2 protein, GST-tagged | +Inquiry |
| AGPAT2-429H | Recombinant Human AGPAT2 Protein, GST-tagged | +Inquiry |
| RFL25135MF | Recombinant Full Length Mouse 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase Beta(Agpat2) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AGPAT2-8977HCL | Recombinant Human AGPAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGPAT2 Products
Required fields are marked with *
My Review for All AGPAT2 Products
Required fields are marked with *
