Recombinant Human AGPAT6 protein, His-tagged

• Cat.No.: AGPAT6-2732H
• Product Overview: Recombinant Human AGPAT6 protein(41 - 132 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 41 - 132 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: GIRKLYMKSLLKIFAWATLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCRKGMETIMDDEVT

Gene Information

• Gene Name: AGPAT6 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta) [ Homo sapiens ]
• Official Symbol: AGPAT6
• Synonyms: AGPAT6; 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta); glycerol-3-phosphate acyltransferase 6; DKFZp586M1819; LPAAT zeta; 1-AGP acyltransferase 6; lysophosphatidic acid acyltransferase zeta; testis spermatogenesis apoptosis-related protein 7; 1-acyl-sn-glycerol-3-phosphate acyltransferase zeta; LPAATZ; TSARG7; 1-AGPAT 6; LPAAT-zeta
• Gene ID: 137964
• mRNA Refseq: NM_178819
• Protein Refseq: NP_848934
• MIM: 608143
• UniProt ID: Q86UL3