Recombinant Human AGPAT6 protein, His-tagged

Cat.No. : AGPAT6-2732H
Product Overview : Recombinant Human AGPAT6 protein(41 - 132 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 41 - 132 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : GIRKLYMKSLLKIFAWATLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCRKGMETIMDDEVT
Gene Name AGPAT6 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta) [ Homo sapiens ]
Official Symbol AGPAT6
Synonyms AGPAT6; 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta); glycerol-3-phosphate acyltransferase 6; DKFZp586M1819; LPAAT zeta; 1-AGP acyltransferase 6; lysophosphatidic acid acyltransferase zeta; testis spermatogenesis apoptosis-related protein 7; 1-acyl-sn-glycerol-3-phosphate acyltransferase zeta; LPAATZ; TSARG7; 1-AGPAT 6; LPAAT-zeta;
Gene ID 137964
mRNA Refseq NM_178819
Protein Refseq NP_848934
MIM 608143
UniProt ID Q86UL3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AGPAT6 Products

Required fields are marked with *

My Review for All AGPAT6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon