Recombinant Human AGPAT6 protein, His-tagged
Cat.No. : | AGPAT6-2732H |
Product Overview : | Recombinant Human AGPAT6 protein(41 - 132 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 41 - 132 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | GIRKLYMKSLLKIFAWATLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCRKGMETIMDDEVT |
Gene Name | AGPAT6 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta) [ Homo sapiens ] |
Official Symbol | AGPAT6 |
Synonyms | AGPAT6; 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta); glycerol-3-phosphate acyltransferase 6; DKFZp586M1819; LPAAT zeta; 1-AGP acyltransferase 6; lysophosphatidic acid acyltransferase zeta; testis spermatogenesis apoptosis-related protein 7; 1-acyl-sn-glycerol-3-phosphate acyltransferase zeta; LPAATZ; TSARG7; 1-AGPAT 6; LPAAT-zeta; |
Gene ID | 137964 |
mRNA Refseq | NM_178819 |
Protein Refseq | NP_848934 |
MIM | 608143 |
UniProt ID | Q86UL3 |
◆ Recombinant Proteins | ||
AGPAT6-9478H | Recombinant Human AGPAT6, GST-tagged | +Inquiry |
AGPAT6-3735Z | Recombinant Zebrafish AGPAT6 | +Inquiry |
AGPAT6-2732H | Recombinant Human AGPAT6 protein, His-tagged | +Inquiry |
AGPAT6-1421M | Recombinant Mouse AGPAT6 Protein | +Inquiry |
AGPAT6-391M | Recombinant Mouse AGPAT6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGPAT6-37HCL | Recombinant Human AGPAT6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGPAT6 Products
Required fields are marked with *
My Review for All AGPAT6 Products
Required fields are marked with *