Recombinant Human AGR2, His-tagged
| Cat.No. : | AGR2-63H |
| Product Overview : | Recombinant Human Anterior Gradient Homolog 2 fused to His-tag on N-terminal produced inE.Coliis a single, non-glycosylated polypeptide chain containing 192 amino acids (21-175) & having a molecular mass of 22 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | AGR2 (Anterior gradient 2 homolog) is the human orthologue of the secreted Xenopus laevis Anterior Gradient protein (XAG-2). This is a small, possibly secreted molecule of yet weakly defined functions that is widely expressed in human tissues. Expression of AGR2 shows a positive correlation with expression of estrogen receptor in breast carcinoma and a negative correlation with expression of EGF receptor. |
| Sequence : | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMRDTTVKPGAKKDKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQAL KKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQ YVPRIMFVDPSLTVRADITGRYSNRLYAYE PADTALLLDNMKKALKLLKTEL |
| Physical Appearance : | Sterile filtered clorless solution. |
| Purity : | Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
| Formulation : | The protein (1mg/ml) contains 1X PBS pH-7.4 |
| Applications : | • ELISA • MS • Inhibition Assays • Western Blotting |
| Storage : | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles |
| Gene Name | anterior gradient homolog 2 (Xenopus laevis) [ Homo sapiens ] |
| Synonyms | AG2; GOB-4; HAG-2; XAG-2; PDIA17; AGR2; anterior gradient 2 homolog; secreted cement gland homolog; protein disulfide isomerase family A, member 17; Anterior gradient protein 2 homolog; hAG-2; AG-2; Secreted cement gland protein XAG-2 homolog; HPC8; UNQ515/PRO1030 |
| Gene ID | 10551 |
| mRNA Refseq | NM_006408 |
| Protein Refseq | NP_006399 |
| MIM | 606358 |
| UniProt ID | O95994 |
| Chromosome Location | 7p21.3 |
| Function | protein binding |
| ◆ Recombinant Proteins | ||
| AGR2-1934M | Recombinant Mouse AGR2 protein, His-tagged | +Inquiry |
| AGR2-394M | Recombinant Mouse AGR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| AGR2-3191H | Recombinant Human AGR2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| AGR2-1522H | Recombinant Human AGR2 protein, GST-tagged | +Inquiry |
| AGR2-520H | Recombinant Human AGR2 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AGR2-8972HCL | Recombinant Human AGR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGR2 Products
Required fields are marked with *
My Review for All AGR2 Products
Required fields are marked with *
