Recombinant Human AGR2 Protein, GST-tagged
Cat.No. : | AGR2-440H |
Product Overview : | Human AGR2 partial ORF ( NP_006399, 21 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This protein plays a role in cell migration, cellular transformation and metastasis and is as a p53 inhibitor. As an ER-localized molecular chaperone, it plays a role in the folding, trafficking, and assembly of cysteine-rich transmembrane receptors and the cysteine-rich intestinal gylcoprotein mucin. This gene has been implicated in inflammatory bowel disease and cancer progression. [provided by RefSeq, Mar 2017] |
Molecular Mass : | 35.64 kDa |
AA Sequence : | RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AGR2 anterior gradient 2 homolog (Xenopus laevis) [ Homo sapiens ] |
Official Symbol | AGR2 |
Synonyms | AGR2; anterior gradient 2 homolog (Xenopus laevis); anterior gradient protein 2 homolog; AG2; HAG 2; PDIA17; protein disulfide isomerase family A; member 17; XAG 2; AG-2; HPC8; anterior gradient homolog 2; secreted cement gland homolog; secreted cement gland protein XAG-2 homolog; protein disulfide isomerase family A, member 17; GOB-4; HAG-2; XAG-2; |
Gene ID | 10551 |
mRNA Refseq | NM_006408 |
Protein Refseq | NP_006399 |
MIM | 606358 |
UniProt ID | O95994 |
◆ Recombinant Proteins | ||
Agr2-5888M | Recombinant Mouse Agr2 protein, His-tagged | +Inquiry |
Agr2-1560M | Recombinant Mouse Agr2 Protein, Myc/DDK-tagged | +Inquiry |
AGR2-1425M | Recombinant Mouse AGR2 Protein | +Inquiry |
AGR2-0168H | Recombinant Human AGR2 Protein (Arg21-Leu175), C-His-tagged | +Inquiry |
AGR2-63H | Recombinant Human AGR2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGR2-8972HCL | Recombinant Human AGR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGR2 Products
Required fields are marked with *
My Review for All AGR2 Products
Required fields are marked with *