Recombinant Human AGR3 Protein, GST-tagged

• Cat.No.: AGR3-172H
• Product Overview: Human BCMP11 full-length ORF ( NP_789783.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 45.6 kDa
• AA Sequence: MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AGR3 anterior gradient 3 homolog (Xenopus laevis) [ Homo sapiens ]
• Official Symbol: AGR3
• Synonyms: AGR3; anterior gradient 3 homolog (Xenopus laevis); anterior gradient protein 3 homolog; BCMP11; breast cancer membrane protein 11; hAG 3; HAG3; PDIA18; protein disulfide isomerase family A; member 18; AG-3; anterior gradient homolog 3; protein disulfide isomerase family A, member 18; AG3; hAG-3
• Gene ID: 155465
• mRNA Refseq: NM_176813
• Protein Refseq: NP_789783
• MIM: 609482
• UniProt ID: Q8TD06