Recombinant Human AGR3 Protein, GST-tagged

Cat.No. : AGR3-172H
Product Overview : Human BCMP11 full-length ORF ( NP_789783.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 45.6 kDa
AA Sequence : MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AGR3 anterior gradient 3 homolog (Xenopus laevis) [ Homo sapiens ]
Official Symbol AGR3
Synonyms AGR3; anterior gradient 3 homolog (Xenopus laevis); anterior gradient protein 3 homolog; BCMP11; breast cancer membrane protein 11; hAG 3; HAG3; PDIA18; protein disulfide isomerase family A; member 18; AG-3; anterior gradient homolog 3; protein disulfide isomerase family A, member 18; AG3; hAG-3;
Gene ID 155465
mRNA Refseq NM_176813
Protein Refseq NP_789783
MIM 609482
UniProt ID Q8TD06

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AGR3 Products

Required fields are marked with *

My Review for All AGR3 Products

Required fields are marked with *

0
cart-icon
0
compare icon