Recombinant Human AGR3 Protein, GST-tagged
Cat.No. : | AGR3-172H |
Product Overview : | Human BCMP11 full-length ORF ( NP_789783.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 45.6 kDa |
AA Sequence : | MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AGR3 anterior gradient 3 homolog (Xenopus laevis) [ Homo sapiens ] |
Official Symbol | AGR3 |
Synonyms | AGR3; anterior gradient 3 homolog (Xenopus laevis); anterior gradient protein 3 homolog; BCMP11; breast cancer membrane protein 11; hAG 3; HAG3; PDIA18; protein disulfide isomerase family A; member 18; AG-3; anterior gradient homolog 3; protein disulfide isomerase family A, member 18; AG3; hAG-3; |
Gene ID | 155465 |
mRNA Refseq | NM_176813 |
Protein Refseq | NP_789783 |
MIM | 609482 |
UniProt ID | Q8TD06 |
◆ Recombinant Proteins | ||
AGR3-26657TH | Recombinant Human AGR3, His-tagged | +Inquiry |
AGR3-395M | Recombinant Mouse AGR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
AGR3-1426M | Recombinant Mouse AGR3 Protein | +Inquiry |
AGR3-4422C | Recombinant Chicken AGR3 | +Inquiry |
AGR3-518H | Recombinant Human AGR3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGR3-8971HCL | Recombinant Human AGR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGR3 Products
Required fields are marked with *
My Review for All AGR3 Products
Required fields are marked with *