Recombinant Human AGTR1, GST-tagged
Cat.No. : | AGTR1-29H |
Product Overview : | Recombinant Human AGTR1 (250 a.a. - 359 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors. This gene encodes the type 1 receptor which is thought to mediate the major cardiovascular effects of angiotensin II. This gene may play a role in the generation of reperfusion arrhythmias following restoration of blood flow to ischemic or infarcted myocardium. It was previously thought that a related gene, denoted as AGTR1B, existed; however, it is now believed that there is only one type 1 receptor gene in humans. Multiple alternatively spliced transcript variants have been reported for this gene. |
Molecular Mass : | 37.73 kDa |
Sequence : | FFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRHSDNVSSSTKKPAPCFEVE |
Storage buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Applications : | ELISA; WB |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
OfficialSymbol : | AGTR1 |
Gene Name | AGTR1 angiotensin II receptor, type 1 [ Homo sapiens ] |
Synonyms | AGTR1; angiotensin II receptor, type 1; AT1; AG2S; AT1B; AT1R; AT1AR; AT1BR; AT2R1; HAT1R; AGTR1A; AGTR1B; AT2R1A; AT2R1B; type-1 angiotensin II receptor; type-1B angiotensin II receptor; Angiotensin II type-1 receptor |
Gene ID | 185 |
mRNA Refseq | NM_000685 |
Protein Refseq | NP_000676 |
MIM | 106165 |
UniProt ID | P30556 |
Chromosome Location | 3q24 |
Pathway | ACE Inhibitor Pathway; Angiopoietin receptor Tie2-mediated signaling; Arf6 signaling events |
Function | G-protein coupled receptor activity; acetyltransferase activator activity; angiotensin type I receptor activity; angiotensin type I receptor activity; angiotensin type II receptor activity |
◆ Cell & Tissue Lysates | ||
AGTR1-8970HCL | Recombinant Human AGTR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGTR1 Products
Required fields are marked with *
My Review for All AGTR1 Products
Required fields are marked with *