Recombinant Human AGXT

Cat.No. : AGXT-26660TH
Product Overview : Recombinant fragment of Human AGXT with N-terminal proprietary tag. Predicted MW 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene is expressed only in the liver and the encoded protein is localized mostly in the peroxisomes, where it is involved in glyoxylate detoxification. Mutations in this gene, some of which alter subcellular targetting, have been associated with type I primary hyperoxaluria.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Liver.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVIDHFDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVTEALRAALQHCPKKKL
Sequence Similarities : Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family.
Gene Name AGXT alanine-glyoxylate aminotransferase [ Homo sapiens ]
Official Symbol AGXT
Synonyms AGXT; alanine-glyoxylate aminotransferase; SPAT; serine--pyruvate aminotransferase; AGT; AGT1; AGXT1; glycolicaciduria; L alanine: glyoxylate aminotransferase 1; oxalosis I; PH1; primary hyperoxaluria type 1; serine:pyruvate aminotransferase; SPT;
Gene ID 189
mRNA Refseq NM_000030
Protein Refseq NP_000021
MIM 604285
Uniprot ID P21549
Chromosome Location 2q37.3
Pathway Alanine and aspartate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; Glycine, serine and threonine metabolism, organism-specific biosystem; Glycine, serine and threonine metabolism, conserved biosystem;
Function alanine-glyoxylate transaminase activity; amino acid binding; protein binding; protein homodimerization activity; pyridoxal phosphate binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AGXT Products

Required fields are marked with *

My Review for All AGXT Products

Required fields are marked with *

0
cart-icon