Recombinant Human AGXT
Cat.No. : | AGXT-26660TH |
Product Overview : | Recombinant fragment of Human AGXT with N-terminal proprietary tag. Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene is expressed only in the liver and the encoded protein is localized mostly in the peroxisomes, where it is involved in glyoxylate detoxification. Mutations in this gene, some of which alter subcellular targetting, have been associated with type I primary hyperoxaluria. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Liver. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVIDHFDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVTEALRAALQHCPKKKL |
Sequence Similarities : | Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. |
Gene Name | AGXT alanine-glyoxylate aminotransferase [ Homo sapiens ] |
Official Symbol | AGXT |
Synonyms | AGXT; alanine-glyoxylate aminotransferase; SPAT; serine--pyruvate aminotransferase; AGT; AGT1; AGXT1; glycolicaciduria; L alanine: glyoxylate aminotransferase 1; oxalosis I; PH1; primary hyperoxaluria type 1; serine:pyruvate aminotransferase; SPT; |
Gene ID | 189 |
mRNA Refseq | NM_000030 |
Protein Refseq | NP_000021 |
MIM | 604285 |
Uniprot ID | P21549 |
Chromosome Location | 2q37.3 |
Pathway | Alanine and aspartate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; Glycine, serine and threonine metabolism, organism-specific biosystem; Glycine, serine and threonine metabolism, conserved biosystem; |
Function | alanine-glyoxylate transaminase activity; amino acid binding; protein binding; protein homodimerization activity; pyridoxal phosphate binding; |
◆ Recombinant Proteins | ||
AGXT-503H | Recombinant Human AGXT Protein, His-tagged | +Inquiry |
AGXT-938HF | Recombinant Full Length Human AGXT Protein, GST-tagged | +Inquiry |
AGXT-26660TH | Recombinant Human AGXT | +Inquiry |
AGXT-0645H | Recombinant Human AGXT Protein (Met1-Leu392), N-His-tagged | +Inquiry |
AGXT-314M | Recombinant Mouse AGXT Protein (25-414 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGXT-8967HCL | Recombinant Human AGXT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGXT Products
Required fields are marked with *
My Review for All AGXT Products
Required fields are marked with *