Recombinant Human AHNAK Protein, GST-tagged
| Cat.No. : | AHNAK-461H |
| Product Overview : | Human AHNAK partial ORF ( NP_076965, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a large (700 kDa) structural scaffold protein consisting of a central domain with 128 aa repeats. The encoded protein may play a role in such diverse processes as blood-brain barrier formation, cell structure and migration, cardiac calcium channel regulation, and tumor metastasis. A much shorter variant encoding a 17 kDa isoform exists for this gene, and the shorter isoform initiates a feedback loop that regulates alternative splicing of this gene. [provided by RefSeq, Oct 2016] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | MEKEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAARTGVVKEGDQIVGATIYFDNLQSGEVTQLLNTMGHHTVGLKLHRKGDRSPEPGQTW |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | AHNAK AHNAK nucleoprotein [ Homo sapiens ] |
| Official Symbol | AHNAK |
| Synonyms | AHNAK; AHNAK nucleoprotein; AHNAK nucleoprotein (desmoyokin); neuroblast differentiation-associated protein AHNAK; desmoyokin; MGC5395; AHNAK-related; AHNAKRS; |
| Gene ID | 79026 |
| mRNA Refseq | NM_001620 |
| Protein Refseq | NP_001611 |
| MIM | 103390 |
| UniProt ID | Q09666 |
| ◆ Recombinant Proteins | ||
| AHNAK-1699H | Recombinant Human AHNAK protein, His & T7-tagged | +Inquiry |
| AHNAK-1296HFL | Recombinant Full Length Human AHNAK Protein, C-Flag-tagged | +Inquiry |
| AHNAK-297H | Recombinant Human AHNAK Protein, His (Fc)-Avi-tagged | +Inquiry |
| AHNAK-461H | Recombinant Human AHNAK Protein, GST-tagged | +Inquiry |
| AHNAK-460H | Recombinant Human AHNAK Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AHNAK-8963HCL | Recombinant Human AHNAK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AHNAK Products
Required fields are marked with *
My Review for All AHNAK Products
Required fields are marked with *



