Recombinant Human AHNAK2 protein, His-tagged
Cat.No. : | AHNAK2-6833H |
Product Overview : | Recombinant Human AHNAK2 protein(1-134 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-134 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MRLPETQVLPGEIDETPLSKPGHDLASMEDKTEKWSSQPEGPLKLKASSTDMPSQISVVNVDQLWEDSVLTVKFPKLMVPRFSFAAPSSEDDVFIPTVREVQCPEANIDTALCKESPGLWGASILKAGAGVPGE |
Gene Name | AHNAK2 AHNAK nucleoprotein 2 [ Homo sapiens ] |
Official Symbol | AHNAK2 |
Synonyms | AHNAK2; AHNAK nucleoprotein 2; C14orf78, chromosome 14 open reading frame 78; protein AHNAK2; C14orf78; KIAA2019; |
Gene ID | 113146 |
mRNA Refseq | NM_138420 |
Protein Refseq | NP_612429 |
MIM | 608570 |
UniProt ID | Q8IVF2 |
◆ Recombinant Proteins | ||
AHNAK2-462H | Recombinant Human AHNAK2 Protein, GST-tagged | +Inquiry |
AHNAK2-6833H | Recombinant Human AHNAK2 protein, His-tagged | +Inquiry |
AHNAK2-9496H | Recombinant Human AHNAK2, GST-tagged | +Inquiry |
AHNAK2-463H | Recombinant Human AHNAK2 Protein, GST-tagged | +Inquiry |
AHNAK2-949HF | Recombinant Full Length Human AHNAK2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AHNAK2-42HCL | Recombinant Human AHNAK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AHNAK2 Products
Required fields are marked with *
My Review for All AHNAK2 Products
Required fields are marked with *
0
Inquiry Basket