Recombinant Human AHSA1 Protein, GST-tagged
Cat.No. : | AHRR-466H |
Product Overview : | Human AHRR partial ORF ( NP_065782, 617 a.a. - 715 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene participates in the aryl hydrocarbon receptor (AhR) signaling cascade, which mediates dioxin toxicity, and is involved in regulation of cell growth and differentiation. It functions as a feedback modulator by repressing AhR-dependent gene expression. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jun 2011] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | RATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AHRR aryl-hydrocarbon receptor repressor [ Homo sapiens ] |
Official Symbol | AHRR |
Synonyms | AHRR; aryl-hydrocarbon receptor repressor; AHH, AHHR, aryl hydrocarbon receptor regulator; aryl hydrocarbon receptor repressor; bHLHe77; KIAA1234; ahR repressor; dioxin receptor repressor; aryl hydrocarbon hydroxylase regulator; class E basic helix-loop-helix protein 77; AHH; AHHR; MGC167813; MGC176630; |
Gene ID | 57491 |
mRNA Refseq | NM_001242412 |
Protein Refseq | NP_001229341 |
MIM | 606517 |
UniProt ID | A9YTQ3 |
◆ Recombinant Proteins | ||
AHRR-3649H | Recombinant Human AHRR, His-tagged | +Inquiry |
AHRR-465H | Recombinant Human AHRR Protein, GST-tagged | +Inquiry |
AHRR-1444M | Recombinant Mouse AHRR Protein | +Inquiry |
AHRR-573R | Recombinant Rat AHRR Protein | +Inquiry |
AHRR-1698H | Recombinant Human AHRR protein, His & GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AHRR Products
Required fields are marked with *
My Review for All AHRR Products
Required fields are marked with *
0
Inquiry Basket