Recombinant Human AIF1 protein, His-SUMO-tagged
| Cat.No. : | AIF1-2496H |
| Product Overview : | Recombinant Human AIF1 protein(P55008)(2-147aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-147aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 32.6 kDa |
| AA Sequence : | SQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | AIF1 allograft inflammatory factor 1 [ Homo sapiens ] |
| Official Symbol | AIF1 |
| Synonyms | AIF1; allograft inflammatory factor 1; AIF 1; Em:AF129756.17; IBA1; interferon gamma responsive transcript; ionized calcium binding adapter molecule 1; IRT 1; protein G1; ionized calcium-binding adapter molecule 1; allograft inflammatory factor-1 splice variant Hara-1; IRT1; AIF-1; IRT-1; |
| Gene ID | 199 |
| mRNA Refseq | NM_001623 |
| Protein Refseq | NP_001614 |
| MIM | 601833 |
| UniProt ID | P55008 |
| ◆ Recombinant Proteins | ||
| AIF1-954HF | Recombinant Full Length Human AIF1 Protein, GST-tagged | +Inquiry |
| Aif1-2497M | Recombinant Mouse Aif1 protein, His-tagged | +Inquiry |
| AIF1-106R | Recombinant Rhesus Macaque AIF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| AIF1-100H | Recombinant Human AIF1, His-tagged | +Inquiry |
| AIF1-231R | Recombinant Rat AIF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AIF1-8956HCL | Recombinant Human AIF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AIF1 Products
Required fields are marked with *
My Review for All AIF1 Products
Required fields are marked with *
