Recombinant Human AIFM3 protein, His-tagged

• Cat.No.: AIFM3-9505H
• Product Overview: Recombinant Human AIFM3 protein(355-598 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 355-598 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: AHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVETGDMSWLTGKGS

Gene Information

• Gene Name: AIFM3 apoptosis-inducing factor, mitochondrion-associated, 3 [ Homo sapiens ]
• Official Symbol: AIFM3
• Synonyms: AIFM3; apoptosis-inducing factor, mitochondrion-associated, 3; apoptosis-inducing factor 3; AIFL; FLJ30473; apoptosis-inducing factor like; FLJ45137
• Gene ID: 150209
• mRNA Refseq: NM_001018060
• Protein Refseq: NP_001018070
• UniProt ID: Q96NN9