Recombinant Human AIFM3 protein, His-tagged
| Cat.No. : | AIFM3-9505H |
| Product Overview : | Recombinant Human AIFM3 protein(355-598 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | May 28, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 355-598 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | AHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVETGDMSWLTGKGS |
| Gene Name | AIFM3 apoptosis-inducing factor, mitochondrion-associated, 3 [ Homo sapiens ] |
| Official Symbol | AIFM3 |
| Synonyms | AIFM3; apoptosis-inducing factor, mitochondrion-associated, 3; apoptosis-inducing factor 3; AIFL; FLJ30473; apoptosis-inducing factor like; FLJ45137; |
| Gene ID | 150209 |
| mRNA Refseq | NM_001018060 |
| Protein Refseq | NP_001018070 |
| UniProt ID | Q96NN9 |
| ◆ Recombinant Proteins | ||
| AIFM3-6904Z | Recombinant Zebrafish AIFM3 | +Inquiry |
| AIFM3-2699H | Recombinant Human AIFM3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| AIFM3-475H | Recombinant Human AIG1 Protein, GST-tagged | +Inquiry |
| AIFM3-413M | Recombinant Mouse AIFM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| AIFM3-9505H | Recombinant Human AIFM3 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AIFM3-8952HCL | Recombinant Human AIFM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AIFM3 Products
Required fields are marked with *
My Review for All AIFM3 Products
Required fields are marked with *
