Recombinant Human AIG1 Protein, GST-tagged

Cat.No. : AIFM3-475H
Product Overview : Human AIFM3 full-length ORF ( NP_001018070.1, 1 a.a. - 598 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : AIFM3 (Apoptosis Inducing Factor, Mitochondria Associated 3) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity and 2 iron, 2 sulfur cluster binding. An important paralog of this gene is AIFM1.
Molecular Mass : 92.4 kDa
AA Sequence : MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHTEERLSTPHPYPSPQDCVEAAVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEKEKVYVRASKQALQLQRRTKVMAKCISPSAGYSSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRTKKVVFKDGFKLEYSKLLLAPGSSPKTLSCKGKEVENVFTIRTPEDANRVVRLARGRNVVVVGAGFLGMEVAAYLTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVETGDMSWLTGKGS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AIFM3 apoptosis-inducing factor, mitochondrion-associated, 3 [ Homo sapiens ]
Official Symbol AIFM3
Synonyms AIFM3; apoptosis-inducing factor, mitochondrion-associated, 3; apoptosis-inducing factor 3; AIFL; FLJ30473; apoptosis-inducing factor like; FLJ45137;
Gene ID 150209
mRNA Refseq NM_001018060
Protein Refseq NP_001018070
MIM 617298
UniProt ID Q96NN9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AIFM3 Products

Required fields are marked with *

My Review for All AIFM3 Products

Required fields are marked with *

0
cart-icon