Recombinant Human AIMP2 Protein (1-320 aa), His-tagged
Cat.No. : | AIMP2-2030H |
Product Overview : | Recombinant Human AIMP2 Protein (1-320 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-320 aa |
Description : | Required for assembly and stability of the aminoacyl-tRNA synthase complex. Mediates ubiquitination and degradation of FUBP1, a transcriptional activator of MYC, leading to MYC down-regulation which is required for aveolar type II cell differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 39.3 kDa |
AA Sequence : | MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | AIMP2 aminoacyl tRNA synthetase complex-interacting multifunctional protein 2 [ Homo sapiens ] |
Official Symbol | AIMP2 |
Synonyms | AIMP2; JTV 1; JTV1; p38; PRO0992; protein JTV-1; P38; JTV-1; |
Gene ID | 7965 |
mRNA Refseq | NM_006303 |
Protein Refseq | NP_006294 |
MIM | 600859 |
UniProt ID | Q13155 |
◆ Recombinant Proteins | ||
AIMP2-2030H | Recombinant Human AIMP2 Protein (1-320 aa), His-tagged | +Inquiry |
AIMP2-233R | Recombinant Rat AIMP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AIMP2-12523Z | Recombinant Zebrafish AIMP2 | +Inquiry |
AIMP2-1458M | Recombinant Mouse AIMP2 Protein | +Inquiry |
AIMP2-416M | Recombinant Mouse AIMP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AIMP2-8951HCL | Recombinant Human AIMP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AIMP2 Products
Required fields are marked with *
My Review for All AIMP2 Products
Required fields are marked with *
0
Inquiry Basket