Recombinant Human AK2 protein, GST-tagged
Cat.No. : | AK2-2501H |
Product Overview : | Recombinant Human AK2 protein(P54819)(1-239aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-239aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 53.5 kDa |
AA Sequence : | MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | AK2 adenylate kinase 2 [ Homo sapiens ] |
Official Symbol | AK2 |
Synonyms | AK2; adenylate kinase 2; adenylate kinase 2, mitochondrial; ATP-AMP transphosphorylase 2; adenylate kinase isoenzyme 2, mitochondrial; ADK2; AK 2; |
Gene ID | 204 |
mRNA Refseq | NM_001199199 |
Protein Refseq | NP_001186128 |
MIM | 103020 |
UniProt ID | P54819 |
◆ Recombinant Proteins | ||
AK2-963HF | Recombinant Full Length Human AK2 Protein, GST-tagged | +Inquiry |
AK2-583R | Recombinant Rat AK2 Protein | +Inquiry |
AK2-239R | Recombinant Rat AK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AK2-11875Z | Recombinant Zebrafish AK2 | +Inquiry |
AK2-2501H | Recombinant Human AK2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AK2-508HCL | Recombinant Human AK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AK2 Products
Required fields are marked with *
My Review for All AK2 Products
Required fields are marked with *
0
Inquiry Basket