Recombinant Human AK2 protein, GST-tagged

• Cat.No.: AK2-2501H
• Product Overview: Recombinant Human AK2 protein(P54819)(1-239aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-239aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 53.5 kDa
• AA Sequence: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: AK2 adenylate kinase 2 [ Homo sapiens ]
• Official Symbol: AK2
• Synonyms: AK2; adenylate kinase 2; adenylate kinase 2, mitochondrial; ATP-AMP transphosphorylase 2; adenylate kinase isoenzyme 2, mitochondrial; ADK2; AK 2
• Gene ID: 204
• mRNA Refseq: NM_001199199
• Protein Refseq: NP_001186128
• MIM: 103020
• UniProt ID: P54819