Recombinant Human AKT1 protein, GST-tagged
Cat.No. : | AKT1-3920H |
Product Overview : | Recombinant Human AKT1(1-224aa) fused with GST tag at N-terminal was expressed in E. coli. |
Availability | October 22, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-224aa |
Description : | The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine/threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Mutations in this gene have been associated with the Proteus syndrome. Multiple alternatively spliced transcript variants have been found for this gene. |
Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol. |
AA Sequence : | MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRPNTFII RCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEF EYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLC |
Storage : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
Gene Name | AKT1 v-akt murine thymoma viral oncogene homolog 1 [ Homo sapiens ] |
Official Symbol | AKT1 |
Synonyms | AKT1; v-akt murine thymoma viral oncogene homolog 1; RAC-alpha serine/threonine-protein kinase; AKT; PKB; PRKBA; RAC; PKB alpha; RAC-PK-alpha; proto-oncogene c-Akt; protein kinase B alpha; rac protein kinase alpha; PKB-ALPHA; RAC-ALPHA; MGC99656; |
Gene ID | 207 |
mRNA Refseq | NM_001014431 |
Protein Refseq | NP_001014431 |
MIM | 164730 |
UniProt ID | P31749 |
Chromosome Location | 14q32.32-q32.33 |
Pathway | AKT phosphorylates targets in the cytosol, organism-specific biosystem; AKT phosphorylates targets in the nucleus, organism-specific biosystem; AKT-mediated inactivation of FOXO1A, organism-specific biosystem; Activation of BAD and translocation to mitochondria, organism-specific biosystem; Activation of BH3-only proteins, organism-specific biosystem; Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; |
Function | ATP binding; ATP binding; enzyme binding; identical protein binding; kinase activity; nitric-oxide synthase regulator activity; nucleotide binding; phosphatidylinositol-3,4,5-trisphosphate binding; phosphatidylinositol-3,4-bisphosphate binding; protein binding; protein kinase activity; protein serine/threonine kinase activity; protein serine/threonine kinase activity; |
◆ Recombinant Proteins | ||
AKT1-14H | Recombinant Human AKT1 Protein, His-tagged | +Inquiry |
AKT1-156H | Recombinant Human AKT1 protein, MYC/DDK-tagged | +Inquiry |
AKT1-2503H | Recombinant Human AKT1 protein, GST-tagged | +Inquiry |
AKT1-03H | Recombinant Human AKT1 Over-expression Lysate, C-Myc/DDK tagged | +Inquiry |
AKT1-8342Z | Recombinant Zebrafish AKT1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKT1-677HCL | Recombinant Human AKT1 cell lysate | +Inquiry |
CPBTT-30930RH | Rabbit Anti-Human AKT Polyclonal Antibody | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKT1 Products
Required fields are marked with *
My Review for All AKT1 Products
Required fields are marked with *