Recombinant Human ALAS2 Protein, GST-tagged
Cat.No. : | ALAS2-431H |
Product Overview : | Human ALAS2 partial ORF ( NP_000023, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The product of this gene specifies an erythroid-specific mitochondrially located enzyme. The encoded protein catalyzes the first step in the heme biosynthetic pathway. Defects in this gene cause X-linked pyridoxine-responsive sideroblastic anemia. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGIGRCPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQKAAPEVQEDVKAFK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ALAS2 aminolevulinate, delta-, synthase 2 [ Homo sapiens ] |
Official Symbol | ALAS2 |
Synonyms | ALAS2; aminolevulinate, delta-, synthase 2; aminolevulinate, delta , synthase 2 (sideroblastic/hypochromic anemia) , ASB; 5-aminolevulinate synthase, erythroid-specific, mitochondrial; sideroblastic/hypochromic anemia; delta-ALA synthase 2; delta-ALA synthetase; 5-aminolevulinic acid synthase 2; delta-aminolevulinate synthase 2; ASB; ANH1; XLSA; ALASE; XLDPP; XLEPP; ALAS-E; FLJ93603; |
Gene ID | 212 |
mRNA Refseq | NM_000032 |
Protein Refseq | NP_000023 |
MIM | 301300 |
UniProt ID | P22557 |
◆ Recombinant Proteins | ||
ALAS2-112H | Recombinant Human ALAS2 Protein, His-tagged | +Inquiry |
ALAS2-1391HF | Recombinant Full Length Human ALAS2 Protein, GST-tagged | +Inquiry |
ALAS2-2505H | Recombinant Human ALAS2 protein, His-tagged | +Inquiry |
ALAS2-9209Z | Recombinant Zebrafish ALAS2 | +Inquiry |
Alas2-2506M | Recombinant Mouse Alas2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALAS2-55HCL | Recombinant Human ALAS2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALAS2 Products
Required fields are marked with *
My Review for All ALAS2 Products
Required fields are marked with *