Recombinant Human ALAS2 Protein, GST-tagged
| Cat.No. : | ALAS2-431H |
| Product Overview : | Human ALAS2 partial ORF ( NP_000023, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The product of this gene specifies an erythroid-specific mitochondrially located enzyme. The encoded protein catalyzes the first step in the heme biosynthetic pathway. Defects in this gene cause X-linked pyridoxine-responsive sideroblastic anemia. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | MVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGIGRCPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQKAAPEVQEDVKAFK |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ALAS2 aminolevulinate, delta-, synthase 2 [ Homo sapiens ] |
| Official Symbol | ALAS2 |
| Synonyms | ALAS2; aminolevulinate, delta-, synthase 2; aminolevulinate, delta , synthase 2 (sideroblastic/hypochromic anemia) , ASB; 5-aminolevulinate synthase, erythroid-specific, mitochondrial; sideroblastic/hypochromic anemia; delta-ALA synthase 2; delta-ALA synthetase; 5-aminolevulinic acid synthase 2; delta-aminolevulinate synthase 2; ASB; ANH1; XLSA; ALASE; XLDPP; XLEPP; ALAS-E; FLJ93603; |
| Gene ID | 212 |
| mRNA Refseq | NM_000032 |
| Protein Refseq | NP_000023 |
| MIM | 301300 |
| UniProt ID | P22557 |
| ◆ Recombinant Proteins | ||
| Alas2-113M | Recombinant Mouse Alas2 Protein, His-tagged | +Inquiry |
| ALAS2-112H | Recombinant Human ALAS2 Protein, His-tagged | +Inquiry |
| ALAS2-27277TH | Recombinant Human ALAS2, His-tagged | +Inquiry |
| ALAS2-267R | Recombinant Rat ALAS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Alas2-2506M | Recombinant Mouse Alas2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ALAS2-55HCL | Recombinant Human ALAS2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALAS2 Products
Required fields are marked with *
My Review for All ALAS2 Products
Required fields are marked with *
