Recombinant Human ALCAM protein, T7/His-tagged
Cat.No. : | ALCAM-112H |
Product Overview : | Recombinant human CD166 extracellular domain cDNA (28 - 527 aa, Isoform 1) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 28-527 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFWYTVNSAYGDTIIIPCRLDVPQNLMFGKWKYEKPDGSPVFIAFRSS TKKSVQYDDVPEYKDRLNLSENYTLSISNARISDEKRFVCMLVTEDNVFEAPTIVKVFKQPSKPEIVSKALFLET EQLKKLGDCISEDSYPDGNITWYRNGKVLHPLEGAVVIIFKKEMDPVTQLYTMTSTLEYKTTKADIQMPFTCSVT YYGPSGQKTIHSEQAVFDIYYPTEQVTIQVLPPKNAIKEGDNITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTY TLTDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDALPVSCTISASRNATVVWMKDNIRL RSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKMTKKTDPSGLSKTIICHVEGFPKPAIQWT ITGSGSVINQTEESPYINGRYYSKIIISPEENVTLTCTAENQLERTVNSLNVSAISIPEHDEADEISDENREKVN DQAK |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Protein can be used as coating matrix protein for human T or B cell functions and differentiation regulation study in vitro. P2. As potential biomarker protein for cardiovascular diseases and tumor diagnostic development.3. As antigen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | ALCAM activated leukocyte cell adhesion molecule [ Homo sapiens ] |
Official Symbol | ALCAM |
Synonyms | ALCAM; activated leukocyte cell adhesion molecule; activated leucocyte cell adhesion molecule; CD166 antigen; CD166; MEMD; FLJ38514; MGC71733; |
Gene ID | 214 |
mRNA Refseq | NM_001243280 |
Protein Refseq | NP_001230209 |
MIM | 601662 |
UniProt ID | Q13740 |
Chromosome Location | 3q13.1 |
Pathway | Axon guidance, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Developmental Biology, organism-specific biosystem; L1CAM interactions, organism-specific biosystem; |
Function | receptor binding; |
◆ Recombinant Proteins | ||
ALCAM-6734C | Recombinant Chicken ALCAM | +Inquiry |
ALCAM-4382H | Recombinant Human ALCAM protein, His-SUMO-tagged | +Inquiry |
ALCAM-508R | Recombinant Rabbit ALCAM protein, His-tagged | +Inquiry |
ALCAM-27218TH | Recombinant Human ALCAM | +Inquiry |
Alcam-7465R | Active Recombinant Rat Alcam protein(Met1-Lys527), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALCAM-2644MCL | Recombinant Mouse ALCAM cell lysate | +Inquiry |
ALCAM-2294HCL | Recombinant Human ALCAM cell lysate | +Inquiry |
ALCAM-1098CCL | Recombinant Cynomolgus ALCAM cell lysate | +Inquiry |
ALCAM-828RCL | Recombinant Rat ALCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALCAM Products
Required fields are marked with *
My Review for All ALCAM Products
Required fields are marked with *