Recombinant Human ALDH3B2 Protein, GST-tagged

Cat.No. : ALDH3B2-448H
Product Overview : Human ALDH3B2 full-length ORF ( AAH07685, 1 a.a. - 385 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the aldehyde dehydrogenase family, a group of isozymes that may play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. The gene of this particular family member is over 10 kb in length. The expression of these transcripts is restricted to the salivary gland among the human tissues examined. Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008]
Molecular Mass : 68.09 kDa
AA Sequence : MKDEPRSTNLFMKLDSVFIWKEPFGLVLIIAPWNYPLNLTLVLLVGALAAGSCVVLKPSEISQGTEKVLAEVLPQYLDQSCFAVVLGGPQETGQLLEHKLDYIFFTGSPRVGKIVMTAATKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFCYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGCGRVAIGGQSNESDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVQSVDEAIKFINWQEKPLALYAFSNSSQVVNQMLERTSSGSFGGNEGFTYISLLSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLAPSGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ALDH3B2 aldehyde dehydrogenase 3 family, member B2 [ Homo sapiens ]
Official Symbol ALDH3B2
Synonyms ALDH3B2; aldehyde dehydrogenase 3 family, member B2; ALDH8; aldehyde dehydrogenase family 3 member B2; acetaldehyde dehydrogenase 8; aldehyde dehydrogenase 8;
Gene ID 222
mRNA Refseq NM_000695
Protein Refseq NP_000686
MIM 601917
UniProt ID P48448

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALDH3B2 Products

Required fields are marked with *

My Review for All ALDH3B2 Products

Required fields are marked with *

0
cart-icon
0
compare icon