Recombinant Human ALDH3B2 Protein, GST-tagged
Cat.No. : | ALDH3B2-448H |
Product Overview : | Human ALDH3B2 full-length ORF ( AAH07685, 1 a.a. - 385 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the aldehyde dehydrogenase family, a group of isozymes that may play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. The gene of this particular family member is over 10 kb in length. The expression of these transcripts is restricted to the salivary gland among the human tissues examined. Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 68.09 kDa |
AA Sequence : | MKDEPRSTNLFMKLDSVFIWKEPFGLVLIIAPWNYPLNLTLVLLVGALAAGSCVVLKPSEISQGTEKVLAEVLPQYLDQSCFAVVLGGPQETGQLLEHKLDYIFFTGSPRVGKIVMTAATKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFCYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGCGRVAIGGQSNESDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVQSVDEAIKFINWQEKPLALYAFSNSSQVVNQMLERTSSGSFGGNEGFTYISLLSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLAPSGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ALDH3B2 aldehyde dehydrogenase 3 family, member B2 [ Homo sapiens ] |
Official Symbol | ALDH3B2 |
Synonyms | ALDH3B2; aldehyde dehydrogenase 3 family, member B2; ALDH8; aldehyde dehydrogenase family 3 member B2; acetaldehyde dehydrogenase 8; aldehyde dehydrogenase 8; |
Gene ID | 222 |
mRNA Refseq | NM_000695 |
Protein Refseq | NP_000686 |
MIM | 601917 |
UniProt ID | P48448 |
◆ Recombinant Proteins | ||
ALDH3B2-497H | Recombinant Human Aldehyde Dehydrogenase 3 Family, Member B2, GST-tagged | +Inquiry |
ALDH3B2-1408HF | Recombinant Full Length Human ALDH3B2 Protein, GST-tagged | +Inquiry |
ALDH3B2-448H | Recombinant Human ALDH3B2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDH3B2-59HCL | Recombinant Human ALDH3B2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALDH3B2 Products
Required fields are marked with *
My Review for All ALDH3B2 Products
Required fields are marked with *
0
Inquiry Basket