Recombinant Human ALG10 Protein, GST-tagged
| Cat.No. : | ALG10-460H |
| Product Overview : | Human ALG10 partial ORF ( NP_116223, 48 a.a. - 97 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a membrane-associated protein that adds the third glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation. That is, it transfers the terminal glucose from dolichyl phosphate glucose (Dol-P-Glc) onto the lipid-linked oligosaccharide Glc2Man9GlcNAc(2)-PP-Dol. The rat protein homolog was shown to specifically modulate the gating function of the rat neuronal ether-a-go-go (EAG) potassium ion channel. [provided by RefSeq, Jan 2010] |
| Molecular Mass : | 31.24 kDa |
| AA Sequence : | KLTEAWKTELQKKEDRLPPIKGPFAEFRKILQFLLAYSMSFKNLSMLLLL |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ALG10 asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog (S. pombe) [ Homo sapiens ] |
| Official Symbol | ALG10 |
| Synonyms | ALG10; asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog (S. pombe); asparagine linked glycosylation 10, alpha 1,2 glucosyltransferase homolog (yeast); dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase; derepression of ITR1 expression 2 homolog (S. cerevisiae); DIE2; FLJ14751; alpha2-glucosyltransferase; potassium channel regulator 1; alpha-2-glucosyltransferase ALG10-A; alpha-1,2-glucosyltransferase ALG10-A; derepression of ITR1 expression 2 homolog; asparagine-linked glycosylation protein 10 homolog A; asparagine-linked glycosylation 10 homolog (yeast, alpha-1,2-glucosyltransferase); KCR1; |
| Gene ID | 84920 |
| mRNA Refseq | NM_032834 |
| Protein Refseq | NP_116223 |
| MIM | 603313 |
| UniProt ID | Q5BKT4 |
| ◆ Recombinant Proteins | ||
| ALG10-283R | Recombinant Rat ALG10 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ALG10-3045C | Recombinant Chicken ALG10 | +Inquiry |
| ALG10-460H | Recombinant Human ALG10 Protein, GST-tagged | +Inquiry |
| ALG10-627R | Recombinant Rat ALG10 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALG10 Products
Required fields are marked with *
My Review for All ALG10 Products
Required fields are marked with *
