Recombinant Human ALG10 Protein, GST-tagged

Cat.No. : ALG10-460H
Product Overview : Human ALG10 partial ORF ( NP_116223, 48 a.a. - 97 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a membrane-associated protein that adds the third glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation. That is, it transfers the terminal glucose from dolichyl phosphate glucose (Dol-P-Glc) onto the lipid-linked oligosaccharide Glc2Man9GlcNAc(2)-PP-Dol. The rat protein homolog was shown to specifically modulate the gating function of the rat neuronal ether-a-go-go (EAG) potassium ion channel. [provided by RefSeq, Jan 2010]
Molecular Mass : 31.24 kDa
AA Sequence : KLTEAWKTELQKKEDRLPPIKGPFAEFRKILQFLLAYSMSFKNLSMLLLL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ALG10 asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog (S. pombe) [ Homo sapiens ]
Official Symbol ALG10
Synonyms ALG10; asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog (S. pombe); asparagine linked glycosylation 10, alpha 1,2 glucosyltransferase homolog (yeast); dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase; derepression of ITR1 expression 2 homolog (S. cerevisiae); DIE2; FLJ14751; alpha2-glucosyltransferase; potassium channel regulator 1; alpha-2-glucosyltransferase ALG10-A; alpha-1,2-glucosyltransferase ALG10-A; derepression of ITR1 expression 2 homolog; asparagine-linked glycosylation protein 10 homolog A; asparagine-linked glycosylation 10 homolog (yeast, alpha-1,2-glucosyltransferase); KCR1;
Gene ID 84920
mRNA Refseq NM_032834
Protein Refseq NP_116223
MIM 603313
UniProt ID Q5BKT4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALG10 Products

Required fields are marked with *

My Review for All ALG10 Products

Required fields are marked with *

0
cart-icon