Recombinant Human ALG5 Protein, GST-tagged
Cat.No. : | ALG5-465H |
Product Overview : | Human ALG5 full-length ORF ( AAH12531, 1 a.a. - 324 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the glycosyltransferase 2 family. The encoded protein participates in glucosylation of the oligomannose core in N-linked glycosylation of proteins. The addition of glucose residues to the oligomannose core is necessary to ensure substrate recognition, and therefore, effectual transfer of the oligomannose core to the nascent glycoproteins. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2008] |
Molecular Mass : | 61.38 kDa |
AA Sequence : | MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWFLCVKGIRDTQCGFKLFTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLEQTRKMN |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ALG5 asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ALG5 |
Synonyms | ALG5; asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae); asparagine linked glycosylation 5 homolog (yeast, dolichyl phosphate beta glucosyltransferase); dolichyl-phosphate beta-glucosyltransferase; bA421P11.2; dolP-glucosyltransferase; Alg5, S. cerevisiae, homolog of; dolichyl phosphate glucosyltransferase; asparagine-linked glycosylation protein 5 homolog; asparagine-linked glycosylation 5 homolog (yeast, dolichyl-phosphate beta-glucosyltransferase); asparagine-linked glycosylation 5 homolog (S. cerevisiae, dolichyl-phosphate beta-glucosyltransferase); RP11-421P11.2; |
Gene ID | 29880 |
mRNA Refseq | NM_001142364 |
Protein Refseq | NP_001135836 |
MIM | 604565 |
UniProt ID | Q9Y673 |
◆ Recombinant Proteins | ||
ALG5-25H | Recombinant Human ALG5, His-tagged | +Inquiry |
ALG5-1548M | Recombinant Mouse ALG5 Protein | +Inquiry |
ALG5-1436HF | Recombinant Full Length Human ALG5 Protein, GST-tagged | +Inquiry |
ALG5-304R | Recombinant Rhesus monkey ALG5 Protein, His-tagged | +Inquiry |
RFL-31126SF | Recombinant Full Length Schizosaccharomyces Pombe Dolichyl-Phosphate Beta-Glucosyltransferase(Alg5) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALG5-62HCL | Recombinant Human ALG5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALG5 Products
Required fields are marked with *
My Review for All ALG5 Products
Required fields are marked with *
0
Inquiry Basket